CK934031
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI_PHAVU (Ferritin, chloroplastic OS=Phaseolus vulgaris GN=PFE PE=2 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 8.199e-14 Identity = 34/43 (79.07%), Postives = 39/43 (90.70%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHEGDAA 132 EFL EQVEAI KI++YV+QLRMVGKGHG+WHFDQ LLH+G AA Sbjct: 212 EFLSEQVEAIKKISEYVAQLRMVGKGHGVWHFDQSLLHDGHAA 254
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI4_SOYBN (Ferritin-4, chloroplastic OS=Glycine max PE=1 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 1.399e-13 Identity = 35/44 (79.55%), Postives = 41/44 (93.18%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHE-GDAA 132 E+LGEQVEAI +I++YV+QLR VGKGHG+WHFDQMLLHE GDAA Sbjct: 204 EYLGEQVEAIKRISEYVAQLRRVGKGHGVWHFDQMLLHEGGDAA 247
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI3_SOYBN (Ferritin-3, chloroplastic OS=Glycine max PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 1.827e-13 Identity = 34/43 (79.07%), Postives = 38/43 (88.37%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHEGDAA 132 EFLGEQVEAI KI++YV+QLR VGKGHG+WHFDQMLLHE A Sbjct: 213 EFLGEQVEAIKKISEYVAQLRRVGKGHGVWHFDQMLLHEEGVA 255
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI2_VIGUN (Ferritin-2, chloroplastic OS=Vigna unguiculata GN=PFE2 PE=2 SV=2) HSP 1 Score: 74.7146 bits (182), Expect = 2.386e-13 Identity = 32/40 (80.00%), Postives = 38/40 (95.00%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHEG 123 EFLGEQVE+I +I++YV+QLR VGKGHG+WHFDQMLLHEG Sbjct: 207 EFLGEQVESIKRISEYVAQLRRVGKGHGVWHFDQMLLHEG 246
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI2_ARATH (Ferritin-2, chloroplastic OS=Arabidopsis thaliana GN=FER2 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.499e-12 Identity = 30/39 (76.92%), Postives = 37/39 (94.87%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHE 120 EFLGEQVEAI KI++YV+QLR +GKGHG+WHFDQMLL++ Sbjct: 213 EFLGEQVEAIKKISEYVAQLRRIGKGHGVWHFDQMLLND 251
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI1_ARATH (Ferritin-1, chloroplastic OS=Arabidopsis thaliana GN=FER1 PE=1 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 4.499e-12 Identity = 29/38 (76.32%), Postives = 36/38 (94.74%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLH 117 EFLGEQ+EAI KI+ Y++QLRM+GKGHG+WHFDQMLL+ Sbjct: 218 EFLGEQIEAIKKISDYITQLRMIGKGHGVWHFDQMLLN 255
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI3_VIGUN (Ferritin-3, chloroplastic OS=Vigna unguiculata PE=2 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 5.876e-12 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHE 120 EFL EQVE+I KIA+YV+QLR+VGKGHG+WHFDQ LLH+ Sbjct: 218 EFLNEQVESIKKIAEYVTQLRLVGKGHGVWHFDQRLLHD 256
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI1_MAIZE (Ferritin-1, chloroplastic OS=Zea mays GN=FER1 PE=1 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 7.674e-12 Identity = 32/39 (82.05%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLHE 120 EFL EQ EAINKI+KYV+QLR VGKGHG+WHFDQMLL E Sbjct: 214 EFLEEQGEAINKISKYVAQLRRVGKGHGVWHFDQMLLEE 252
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI1_PEA (Ferritin-1, chloroplastic OS=Pisum sativum PE=1 SV=2) HSP 1 Score: 69.3218 bits (168), Expect = 1.002e-11 Identity = 30/39 (76.92%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 1 GEFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLH 117 GE+L EQVEAI KI++YV+QLR VGKGHG+WHFDQ LLH Sbjct: 210 GEYLAEQVEAIKKISEYVAQLRRVGKGHGVWHFDQRLLH 248
BLAST of CK934031 vs. ExPASy Swiss-Prot
Match: FRI1_BRANA (Ferritin-1, chloroplastic OS=Brassica napus GN=LSC30 PE=2 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 1.002e-11 Identity = 29/38 (76.32%), Postives = 36/38 (94.74%), Query Frame = 1 Query: 4 EFLGEQVEAINKIAKYVSQLRMVGKGHGLWHFDQMLLH 117 EFLGEQ+EAI KI+ +++QLRMVGKGHG+WHFDQMLL+ Sbjct: 217 EFLGEQIEAIKKISDFITQLRMVGKGHGVWHFDQMLLN 254 The following BLAST results are available for this feature:
BLAST of CK934031 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK934031 ID=CK934031; Name=CK934031; organism=Citrus sinensis; type=EST; length=484bpback to top |