CK939278
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK939278 vs. ExPASy Swiss-Prot
Match: HEPS2_BACST (Heptaprenyl diphosphate synthase component 2 OS=Bacillus stearothermophilus GN=hepT PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.691e-11 Identity = 38/105 (36.19%), Postives = 64/105 (60.95%), Query Frame = 1 Query: 487 ISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRATAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETV 801 + L ++ +++DL + + L+ V +E L AA + AGGKR+RP V L +R G +L + + +A +E+IH ASL+HDDV+D++D+RRG+ T+ Sbjct: 1 MKLKAMYSFLSDDLAAVEEELERAVQSEYGPLGEAALHLLQAGGKRIRPVFVLLAAR-----FGQYDLE-RMKHVAVALELIHMASLVHDDVIDDADLRRGRPTI 99
BLAST of CK939278 vs. ExPASy Swiss-Prot
Match: DPS1_HUMAN (Decaprenyl-diphosphate synthase subunit 1 OS=Homo sapiens GN=PDSS1 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.919e-11 Identity = 39/116 (33.62%), Postives = 65/116 (56.03%), Query Frame = 1 Query: 472 KSRSPISLANIFEVVAEDLQTLNQNLKSIVGAENPVLMSAAEQIFGAGGKRLRPALVFLVSRA-TAELVGLKELTTKHRRLAEIIEMIHTASLIHDDVLDESDMRRGQETVHQLYG 816 K+ S + F++ DL+ L ++++ + L +E F GK RP +V L++RA + + R +A I EMIHTASL+HDDV+D++ RRG+ TV++++G Sbjct: 85 KTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWG 200 The following BLAST results are available for this feature:
BLAST of CK939278 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 12
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939278 ID=CK939278; Name=CK939278; organism=Citrus sinensis; type=EST; length=816bpback to top |