FC876176

Overview
NameFC876176
Unique NameFC876176
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length700
Libraries
Library NameType
DevOvary1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC876176_ssr108 microsatellite FC876176_ssr108:108..119. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: TMK1_ARATH (Probable receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.212e-27
Identity = 66/153 (43.14%), Postives = 93/153 (60.78%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIPSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIP 673
            D S ML L +SL N PS +   S    C+WT I C  + RVT I +  SGL GTLSP++ +L++LE L  Q NNI+G +PSL+   SLQ + L NNNF S+P+  F GLT+LQ + + +NP    W  P  L  +++L     ++AN+ G +P
Sbjct:   28 DLSAMLSLKKSL-NPPSSFG-WSDPDPCKWTHIVCTGTKRVTRIQIGHSGLQGTLSPDLRNLSELERLELQWNNISGPVPSLSGLASLQVLMLSNNNFDSIPSDVFQGLTSLQSVEIDNNP-FKSWEIPESLRNASALQNFSANSANVSGSLP 177          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: RPK1_IPONI (Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 9.317e-18
Identity = 57/158 (36.08%), Postives = 81/158 (51.27%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSD----WSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIPS-LANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIP 673
            DG+ +L L +   ++PSD    W+++ ST  C W G+ CD    V T++L+  G+SG   PEIS L  L+ +    N   G+IPS L N + L+ I L +N+FT         L NL+ LSL  N  +   PFP  L     L T+Y     + G IP
Sbjct:   27 DGAALLSLTRHWTSIPSDITQSWNASDSTP-CSWLGVECDRRQFVDTLNLSSYGISGEFGPEISHLKHLKKVVLSGNGFFGSIPSQLGNCSLLEHIDLSSNSFTGNIPDTLGALQNLRNLSLFFNSLIG--PFPESLLSIPHLETVYFTGNGLNGSIP 181          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: PEPR1_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.217e-17
Identity = 57/159 (35.85%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSDWSST-----SSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIPS-LANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIP 673
            DG  +L L + L  +P   +ST     S    C W GI CD+S  V +++  +S +SG L PEI  L  L+ L    NN +G IPS L N T L  + L  N F+       D L  L+VL L    N      P  L +   L  LY+D  N+ G IP
Sbjct:   32 DGLTLLSLLKHLDRVPPQVTSTWKINASEATPCNWFGITCDDSKNVASLNFTRSRVSGQLGPEIGELKSLQILDLSTNNFSGTIPSTLGNCTKLATLDLSENGFSDKIPDTLDSLKRLEVLYL--YINFLTGELPESLFRIPKLQVLYLDYNNLTGPIP 188          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: FLS2_ARATH (LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.217e-17
Identity = 52/140 (37.14%), Postives = 79/140 (56.43%), Query Frame = 2
Query:  263 SDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIPS-LANATSLQDIYLDNNNFT-SVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPD 676
            SDW+   S  +C WTGI CD++  V ++SL +  L G LSP I++LT L+ L    N+  G IP+ +   T L  + L  N F+ S+P+G ++ L N+  L L +  NL     P E+ K++SL  +  D  N+ G IP+
Sbjct:   50 SDWTIIGSLRHCNWTGITCDSTGHVVSVSLLEKQLEGVLSPAIANLTYLQVLDLTSNSFTGKIPAEIGKLTELNQLILYLNYFSGSIPSGIWE-LKNIFYLDLRN--NLLSGDVPEEICKTSSLVLIGFDYNNLTGKIPE 186          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: Y5659_ARATH (Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana GN=At5g16590 PE=1 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.487e-15
Identity = 55/157 (35.03%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAI-PSLANATSLQDIYLDNNNFT-SVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDV 679
            D   ++ L   +   P  W+ T+    C W G+ C+ S RVT + L   GLSG L   I +LT+LETLSF+ N + G + P  AN T L+ +YL  N F+  +P+  F  L N+  ++L+ N  L     P+ +  +T L TLY+ +  + G IP++
Sbjct:   28 DRRALIALRDGVHGRPLLWNLTAPP--CTWGGVQCE-SGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFT-LPNIIRINLAQNNFLG--RIPDNVNSATRLATLYLQDNQLTGPIPEI 178          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.328e-15
Identity = 54/160 (33.75%), Postives = 79/160 (49.38%), Query Frame = 2
Query:  218 GSVMLKLAQSLQNLP---SDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIP-SLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDVFY 685
            G  +  L  SL+ LP   SDW+  +    C W+ + CD+ N VT+++L+    SGTLS  +  L  L+TL+ + N I G IP    N TSL  + L++N  T         L  LQ L+LS N        P  LT   +L  L +D+ ++ G IP   +
Sbjct:   31 GDALFALRISLRALPNQLSDWNQ-NQVNPCTWSQVICDDKNFVTSLTLSDMNFSGTLSSRVGILENLKTLTLKGNGITGEIPEDFGNLTSLTSLDLEDNQLTGRIPSTIGNLKKLQFLTLSRNK--LNGTIPESLTGLPNLLNLLLDSNSLSGQIPQSLF 187          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.328e-15
Identity = 51/136 (37.50%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  296 CEWTGINCDNSNRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAI-PSLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDVFYSFFNL 700
            C WT I+C + N V  +      LSGTLS  I +LT L  +S Q NNI+G I P + +   LQ + L NN F+    G  + L+NLQ L L  N N    PFP  L++   L+ L +   N+ G +P      FN+
Sbjct:   63 CSWTMISCSSDNLVIGLGAPSQSLSGTLSGSIGNLTNLRQVSLQNNNISGKIPPEICSLPKLQTLDLSNNRFSGEIPGSVNQLSNLQYLRL--NNNSLSGPFPASLSQIPHLSFLDLSYNNLRGPVPKFPARTFNV 196          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: PEPR2_ARATH (Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.328e-15
Identity = 63/182 (34.62%), Postives = 87/182 (47.80%), Query Frame = 2
Query:  161 ICAVVXXXXXXXXXXXGDDGSVMLKLAQSLQNLP----SDWS-STSSTGYCE--WTGINCDNS-NRVTTISLAKSGLSGTLSPEISSLTQLETLSFQMNNIAGAIPS-LANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDV 679
            +C++              DG  +L L +    +P    S W  +TS T  C   W G+ CD S N V T++L+ SGLSG L  EI  L  L TL   +N+ +G +PS L N TSL+ + L NN+F+      F  L NL  L L D  NL+    P  +     L  L M   N+ G IP++
Sbjct:   12 LCSLFVYFRIDSVSSLNSDGLALLSLLKHFDKVPLEVASTWKENTSETTPCNNNWFGVICDLSGNVVETLNLSASGLSGQLGSEIGELKSLVTLDLSLNSFSGLLPSTLGNCTSLEYLDLSNNDFSGEVPDIFGSLQNLTFLYL-DRNNLSGL-IPASVGGLIELVDLRMSYNNLSGTIPEL 191          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: Y3288_ARATH (Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.259e-14
Identity = 52/158 (32.91%), Postives = 89/158 (56.33%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLS-PEISSLTQLETLSFQMNNIAGAIPS-LANATSLQDIYLDNNNFTS-VPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDV 679
            D   +L +  S++  P  W+ ++S+  C W G++CD + RVT + L  SGL G+L    I +LTQL+TLS + N+++G IPS  +N   L+ +YL  N F+  +P+  F   T   ++ ++   N      P+ +  +T L TLY++   + G IP++
Sbjct:   29 DRRALLAVRNSVRGRPLLWNMSASSP-CNWHGVHCD-AGRVTALRLPGSGLFGSLPIGGIGNLTQLKTLSLRFNSLSGPIPSDFSNLVLLRYLYLQGNAFSGEIPSLLF---TLPSIIRINLGENKFSGRIPDNVNSATRLVTLYLERNQLSGPIPEI 181          
BLAST of FC876176 vs. ExPASy Swiss-Prot
Match: Y1848_ARATH (Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.066e-13
Identity = 50/157 (31.85%), Postives = 83/157 (52.87%), Query Frame = 2
Query:  215 DGSVMLKLAQSLQNLPSDWSSTSSTGYCEWTGINCDNSNRVTTISLAKSGLSGTLSPEI-SSLTQLETLSFQMNNIAGAIP-SLANATSLQDIYLDNNNFTSVPTGCFDGLTNLQVLSLSDNPNLAPWPFPNELTKSTSLTTLYMDNANIFGLIPDV 679
            D + +L L  ++      W+    T  C W G+ C+ SNRVT + L    LSG +   I  +LTQL TLS ++N ++G++P  L+ +++L+ +YL  N F+         L++L  L+L+ N         +  T  T L TL+++N  + G IPD+
Sbjct:   36 DRTALLSLRSAVGGRTFRWN-IKQTSPCNWAGVKCE-SNRVTALRLPGVALSGDIPEGIFGNLTQLRTLSLRLNALSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTG--EISSGFTNLTKLKTLFLENNQLSGSIPDL 188          
The following BLAST results are available for this feature:
BLAST of FC876176 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 29
Match NameE-valueIdentityDescription
TMK1_ARATH2.212e-2743.14Probable receptor protein kinase TMK1 OS=Arabidops... [more]
RPK1_IPONI9.317e-1836.08Receptor-like protein kinase OS=Ipomoea nil GN=INR... [more]
PEPR1_ARATH1.217e-1735.85Leucine-rich repeat receptor-like protein kinase P... [more]
FLS2_ARATH1.217e-1737.14LRR receptor-like serine/threonine-protein kinase ... [more]
Y5659_ARATH1.487e-1535.03Probable inactive receptor kinase At5g16590 OS=Ara... [more]
Y5129_ARATH4.328e-1533.75Probable LRR receptor-like serine/threonine-protei... [more]
Y2239_ARATH4.328e-1537.50Probable LRR receptor-like serine/threonine-protei... [more]
PEPR2_ARATH4.328e-1534.62Leucine-rich repeat receptor-like protein kinase P... [more]
Y3288_ARATH1.259e-1432.91Probable inactive receptor kinase At3g02880 OS=Ara... [more]
Y1848_ARATH1.066e-1331.85Probable inactive receptor kinase At1g48480 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32001C02EF DevOvary1 Citrus clementina cDNA clone C32001C02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC876176 ID=FC876176|Name=FC876176|organism=Citrus clementina|type=EST|length=700bp
CGGGGGAGACTTTCAGTGGGAGGCAGACAGTTCGGTTTGGCTGCTGAACT
AAAAGAAAGCAACAGCAACTCCCTTCATTCAAAAAGAAGAAAATCCAACC
AACCCCAAAAGAAAGAAAGAAACAAACAGACACATGATGCGCAAAAAACC
CCAGGTTTCCATCTGCGCCGTCGTCCTTCTCTTGCTCCAGTTGACGACGA
CGTCGTTGGGCGACGACGGGTCGGTGATGCTGAAGCTAGCTCAGTCGCTG
CAGAACCTACCCTCTGACTGGTCCAGCACATCCTCAACCGGGTACTGCGA
GTGGACCGGCATCAATTGCGACAACTCAAACCGCGTGACAACCATAAGCC
TCGCAAAAAGCGGACTCAGTGGCACTCTTTCGCCGGAAATCTCATCCCTC
ACGCAGCTGGAAACCCTTTCTTTCCAAATGAACAACATTGCCGGCGCCAT
TCCCTCCCTTGCCAACGCGACGTCGTTGCAAGATATCTATTTGGACAACA
ACAACTTCACCAGCGTACCCACTGGCTGCTTCGACGGCTTAACGAACTTG
CAAGTGTTGAGTCTCAGCGACAACCCAAATCTTGCCCCTTGGCCTTTTCC
TAATGAACTGACCAAATCTACAAGCCTCACAACTTTGTACATGGATAATG
CCAACATCTTTGGTCTAATCCCTGACGTTTTTTATTCCTTTTTCAATCTG
back to top