FC920490

Overview
NameFC920490
Unique NameFC920490
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length702
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14152 contig Ccv1_Contig14152:1..702. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_SOLTU (26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 348.977 bits (894), Expect = 1.465e-95
Identity = 183/207 (88.41%), Postives = 193/207 (93.24%), Query Frame = 1
Query:   88 ASAMVLDPKPVSEPPPSTRSD--LTEQWSD-EDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            A+AMVLDPKP +E  P+TR +  +T+  SD EDDLY+RLKSLQRQLEFI+IQEEYVKDE KNL+RE LRAQEEVKRIQSVPLVIGQFMEM+DQNN IVGSTTGSNYYVRILSTINRELLKPSASV L RHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct:    2 ATAMVLDPKP-AEKLPATRPETSITDVPSDGEDDLYARLKSLQRQLEFIEIQEEYVKDELKNLRREHLRAQEEVKRIQSVPLVIGQFMEMIDQNNAIVGSTTGSNYYVRILSTINRELLKPSASVGLDRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 207          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_ARATH (26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 1.914e-95
Identity = 181/205 (88.29%), Postives = 188/205 (91.71%), Query Frame = 1
Query:   85 AASAMVLDPKPVSEPPPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            A ++MVLDPK           DL+   +DE+DLY RLKSL+RQLEF DIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDV+YNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK
Sbjct:    5 AVASMVLDPKA-----SPALMDLST--ADEEDLYGRLKSLERQLEFTDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 202          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_RAT (26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 8.631e-80
Identity = 146/190 (76.84%), Postives = 166/190 (87.37%), Query Frame = 1
Query:  130 PPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            P +  S L  +  D +DLYSR K LQ++LEF+++QEEY+KDEQKNLK+E L AQEEVKRIQS+PLVIGQF+E VDQN  IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GK
Sbjct:   23 PQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGK 212          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_MACFA (26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 8.631e-80
Identity = 146/190 (76.84%), Postives = 166/190 (87.37%), Query Frame = 1
Query:  130 PPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            P +  S L  +  D +DLYSR K LQ++LEF+++QEEY+KDEQKNLK+E L AQEEVKRIQS+PLVIGQF+E VDQN  IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GK
Sbjct:   23 PQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGK 212          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_HUMAN (26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2)

HSP 1 Score: 296.59 bits (758), Expect = 8.631e-80
Identity = 146/190 (76.84%), Postives = 166/190 (87.37%), Query Frame = 1
Query:  130 PPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            P +  S L  +  D +DLYSR K LQ++LEF+++QEEY+KDEQKNLK+E L AQEEVKRIQS+PLVIGQF+E VDQN  IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GK
Sbjct:   23 PQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGK 212          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_BOVIN (26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 8.631e-80
Identity = 146/190 (76.84%), Postives = 166/190 (87.37%), Query Frame = 1
Query:  130 PPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            P +  S L  +  D +DLYSR K LQ++LEF+++QEEY+KDEQKNLK+E L AQEEVKRIQS+PLVIGQF+E VDQN  IVGSTTGSNYYVRILSTI+RELLKP+ASVALH+HSNALVDVLPPEADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GK
Sbjct:   23 PQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGK 212          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_MANSE (26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.472e-79
Identity = 149/200 (74.50%), Postives = 169/200 (84.50%), Query Frame = 1
Query:  100 VLDPKPVSEPPPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            V D K +    P T  +L     + +DLY++ K LQR LEF+++QEEY+KDEQ+NLK+E L AQEEVKRIQSVPLVIGQF+E VDQN GIVGSTTGSNYYVRILSTI+RELLKPSASVALH+HSNALVDVLPPEADSSIS+L   EKPDV Y+DIGG D QKQEIREAVELPLTH ELY+QIGI+PPRGVL+YGPPG GK
Sbjct:   15 VTDAKGLPFAGPQTFDEL-----ESEDLYTKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGK 209          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_MOUSE (26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 1.055e-77
Identity = 142/190 (74.74%), Postives = 164/190 (86.32%), Query Frame = 1
Query:  130 PPSTRSDLTEQWSDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            P +  S L  +  D +DLYSR K LQ++LEF+++QEEY+KDEQKNLK+E L AQEEVKRIQS+PLVIGQF+E VDQN  IV STTGSNYYVR++STI+RELLKP+ASVALH+HSNALVDVLPP ADSSI +L+  +KPDV Y DIGG DIQKQE+REAVELPLTH ELYKQIGIDPPRGVL+YGPPG GK
Sbjct:   23 PQTGLSFLGPEPEDLEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVASTTGSNYYVRMVSTIDRELLKPNASVALHKHSNALVDVLPPAADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGK 212          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_ASPNG (26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 1.167e-76
Identity = 139/178 (78.09%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  166 SDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            +D  D Y+ LK LQR LE+I +QEEY+KDEQ++LKREL+RAQEE+KRIQSVPLVIGQFME +DQN GIV S+TGSNY VRILST++RE LKPS+SVALHRHSNALVD+LPPEADSSI++L ++EKPDVTY D+GG D+QKQEIREAVELPLT  +LYKQIGIDPPRGVLLYGPPGTGK
Sbjct:   36 NDGSDEYATLKRLQRHLEYIQLQEEYIKDEQRSLKRELVRAQEEIKRIQSVPLVIGQFMEAIDQNTGIVQSSTGSNYVVRILSTLDREKLKPSSSVALHRHSNALVDILPPEADSSIAMLGENEKPDVTYADVGGLDMQKQEIREAVELPLTQFDLYKQIGIDPPRGVLLYGPPGTGK 213          
BLAST of FC920490 vs. ExPASy Swiss-Prot
Match: PRS6B_SCHPO (26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe GN=rpt3 PE=2 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.092e-74
Identity = 135/178 (75.84%), Postives = 161/178 (90.45%), Query Frame = 1
Query:  166 SDEDDLYSRLKSLQRQLEFIDIQEEYVKDEQKNLKRELLRAQEEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVTYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGK 699
            ++E DLY+R K+L+RQLE +D+QE ++K++ K+LKREL+RAQEEVKRIQSVPLVIGQF+E +DQN  IVGSTTGSNY VRILST++RELLKPSASVAL RHSNALVD+LPPEADSSIS+L   E+PDV+Y D+GG D+QKQE+REAVELPLT  +LY+QIGIDPPRGVLLYGPPGTGK
Sbjct:    4 TEEIDLYNRWKALERQLEMLDLQEGFIKEDCKSLKRELIRAQEEVKRIQSVPLVIGQFLEAIDQNTAIVGSTTGSNYVVRILSTLDRELLKPSASVALQRHSNALVDILPPEADSSISMLRPDERPDVSYADVGGLDVQKQEVREAVELPLTQGDLYRQIGIDPPRGVLLYGPPGTGK 181          
The following BLAST results are available for this feature:
BLAST of FC920490 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 147
Match NameE-valueIdentityDescription
PRS6B_SOLTU1.465e-9588.4126S protease regulatory subunit 6B homolog OS=Sola... [more]
PRS6B_ARATH1.914e-9588.2926S protease regulatory subunit 6B homolog OS=Arab... [more]
PRS6B_RAT8.631e-8076.8426S protease regulatory subunit 6B OS=Rattus norve... [more]
PRS6B_MACFA8.631e-8076.8426S protease regulatory subunit 6B OS=Macaca fasci... [more]
PRS6B_HUMAN8.631e-8076.8426S protease regulatory subunit 6B OS=Homo sapiens... [more]
PRS6B_BOVIN8.631e-8076.8426S protease regulatory subunit 6B OS=Bos taurus G... [more]
PRS6B_MANSE1.472e-7974.5026S protease regulatory subunit 6B OS=Manduca sext... [more]
PRS6B_MOUSE1.055e-7774.7426S protease regulatory subunit 6B OS=Mus musculus... [more]
PRS6B_ASPNG1.167e-7678.0926S protease regulatory subunit 6B homolog OS=Aspe... [more]
PRS6B_SCHPO1.092e-7475.8426S protease regulatory subunit 6B homolog OS=Schi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32009A12EF RVDevelop1 Citrus clementina cDNA clone C32009A12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920490 ID=FC920490|Name=FC920490|organism=Citrus clementina|type=EST|length=702bp
CTCGCCGGGGGACAATCATCAATCGACCAATCCTTCGTTACAATTTCTTG
CTGGTCACTCCAAATTCCTCTCAACAAAACAATGGCAGCCTCAGCGATGG
TTCTAGACCCGAAGCCAGTATCGGAGCCACCACCGTCAACAAGATCCGAT
CTGACGGAGCAATGGTCGGACGAAGACGACCTCTACAGCCGACTTAAATC
CCTGCAACGGCAGCTCGAGTTCATCGACATCCAAGAAGAGTACGTCAAAG
ACGAGCAAAAGAACTTGAAGCGTGAACTGCTACGCGCCCAGGAGGAGGTG
AAGCGGATCCAATCGGTGCCGTTGGTAATCGGACAGTTCATGGAGATGGT
GGACCAGAATAACGGCATCGTGGGGTCCACCACCGGCTCTAACTACTACG
TCAGGATTCTTAGCACTATTAATCGGGAGTTGTTGAAACCGTCCGCTTCC
GTCGCTCTCCACCGTCACTCTAACGCCCTTGTTGACGTTCTTCCGCCGGA
AGCCGATTCCAGTATTTCTCTTCTAAGCCAGTCCGAGAAGCCCGACGTTA
CTTATAATGATATTGGAGGATGTGATATTCAAAAGCAGGAAATTCGTGAG
GCTGTGGAGCTACCGCTGACTCACCATGAGCTATACAAGCAAATTGGTAT
AGATCCTCCACGTGGTGTTTTACTTTATGGTCCTCCTGGAACTGGTAAAC
TA
back to top