FC921355
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC921355 vs. ExPASy Swiss-Prot
Match: CTPA_SYNY3 (Carboxyl-terminal-processing protease OS=Synechocystis sp. (strain PCC 6803) GN=ctpA PE=3 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 6.930e-17 Identity = 43/84 (51.19%), Postives = 61/84 (72.62%), Query Frame = 3 Query: 402 LVTSTTIALSETPS-LALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYLAIRKMLATLDDPFTRLL 650 L+ I L TPS LA +EE +L L++WR ++++Y+D+TFN Q+W+ RE ++ P+ REETY AI +MLATLD+PFTRLL Sbjct: 15 LLMGALIYLGNTPSALAFTEEQKLLLQSWRLVNQSYLDETFNHQNWWLLREKYVK-RPLRNREETYTAIEEMLATLDEPFTRLL 97
BLAST of FC921355 vs. ExPASy Swiss-Prot
Match: CTPA_SYNP2 (Carboxyl-terminal-processing protease OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ctpA PE=3 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 9.367e-14 Identity = 35/70 (50.00%), Postives = 52/70 (74.29%), Query Frame = 3 Query: 441 SLALSEENRLFLEAWRTIDRAYVDKTFNGQSWFRYRENALRNEPMNTREETYLAIRKMLATLDDPFTRLL 650 ++A ++E L L+AWR + +AYVD+TFN Q+W+ R+ L+ P+ TR+E Y A+ +MLA LDDP+TRLL Sbjct: 27 AIAFTDEQDLLLQAWRYVSQAYVDETFNHQNWWLIRQKFLK-RPLKTRDEAYEAVGEMLALLDDPYTRLL 95 The following BLAST results are available for this feature:
BLAST of FC921355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC921355 ID=FC921355; Name=FC921355; organism=Citrus clementina; type=EST; length=654bpback to top |