FC931136
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_RAT (tRNA-specific adenosine deaminase-like protein 3 OS=Rattus norvegicus GN=Adat3 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 9.562e-12 Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 1 Query: 547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681 E + PY+CTGYD+Y+ EPCVMCAMALVH RI+R+FY P+P A Sbjct: 270 EDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGA 314
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_MOUSE (tRNA-specific adenosine deaminase-like protein 3 OS=Mus musculus GN=Adat3 PE=2 SV=1) HSP 1 Score: 70.4774 bits (171), Expect = 9.562e-12 Identity = 29/45 (64.44%), Postives = 36/45 (80.00%), Query Frame = 1 Query: 547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681 E + PY+CTGYD+Y+ EPCVMCAMALVH RI+R+FY P+P A Sbjct: 270 EDSLPYVCTGYDLYVTREPCVMCAMALVHARIQRVFYGAPSPDGA 314
BLAST of FC931136 vs. ExPASy Swiss-Prot
Match: ADAT3_HUMAN (tRNA-specific adenosine deaminase-like protein 3 OS=Homo sapiens GN=ADAT3 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.633e-11 Identity = 29/45 (64.44%), Postives = 33/45 (73.33%), Query Frame = 1 Query: 547 ESARPYLCTGYDIYLVWEPCVMCAMALVHQRIRRIFYAFPNPHEA 681 E PYLCTGYD+Y+ EPC MCAMALVH RI R+FY P+P A Sbjct: 272 EDGLPYLCTGYDLYVTREPCAMCAMALVHARILRVFYGAPSPDGA 316 The following BLAST results are available for this feature:
BLAST of FC931136 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >FC931136 ID=FC931136; Name=FC931136; organism=Citrus clementina; type=EST; length=686bpback to top |