CB304400

Overview
NameCB304400
Unique NameCB304400
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length661
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1557 contig Csv1_Contig1557:321..981. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304400 vs. ExPASy Swiss-Prot
Match: SYP52_ARATH (Syntaxin-52 OS=Arabidopsis thaliana GN=SYP52 PE=1 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 2.013e-72
Identity = 139/196 (70.92%), Postives = 161/196 (82.14%), Query Frame = -2
Query:   73 ESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKSADVMNRATGLDNQGLVGFQRQIMREQDERLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMXXXXXXXXXXXXXIYMLIKYL 660
            ++QR ASAIRRKITILGTRLDSLQSLL K+PGKQ +SEKEMNRRKDM+ NLRSK NQ+AS LNMSNFANRDSL G ++K  D +NR +G+DNQG+V FQRQ+MREQDE LEKLEETV+STKHIALAVNEEL L TRLIDDLD  VD+TDSRLRRVQK+LA++NK  K GC+CM M             I++L+KYL
Sbjct:   38 DAQRRASAIRRKITILGTRLDSLQSLLVKVPGKQHVSEKEMNRRKDMVGNLRSKTNQVASALNMSNFANRDSLFGTDLKPDDAINRVSGMDNQGIVVFQRQVMREQDEGLEKLEETVMSTKHIALAVNEELTLQTRLIDDLDYDVDITDSRLRRVQKSLALMNKSMKSGCSCMSMLLSVLGIVGLALVIWLLVKYL 233          
BLAST of CB304400 vs. ExPASy Swiss-Prot
Match: SYP51_ARATH (Syntaxin-51 OS=Arabidopsis thaliana GN=SYP51 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 7.650e-72
Identity = 138/196 (70.41%), Postives = 163/196 (83.16%), Query Frame = -2
Query:   73 ESQRHASAIRRKITILGTRLDSLQSLLSKLPGKQPISEKEMNRRKDMLANLRSKVNQMASTLNMSNFANRDSLLGPEIKSADVMNRATGLDNQGLVGFQRQIMREQDERLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCMXXXXXXXXXXXXXIYMLIKYL 660
            ++QR ASAIRRKITI G +LDSLQSLL+++ GK PISEKEMNRRKDM+ NLRSK NQMA+ LNMSNFANRDSLLGP+IK  D M+R TG+DNQG+VG+QRQ+MREQDE LE+LE TV+STKHIALAV+EELDL TRLIDDLD HVDVTDSRLRRVQK+LA++NK  + GC+CM M             I+ML+KY+
Sbjct:   38 DAQRRASAIRRKITIFGNKLDSLQSLLAEIHGK-PISEKEMNRRKDMVGNLRSKANQMANALNMSNFANRDSLLGPDIKPDDSMSRVTGMDNQGIVGYQRQVMREQDEGLEQLEGTVMSTKHIALAVSEELDLQTRLIDDLDYHVDVTDSRLRRVQKSLAVMNKNMRSGCSCMSMLLSVLGIVGLAVVIWMLVKYM 232          
BLAST of CB304400 vs. ExPASy Swiss-Prot
Match: STX8B_DICDI (Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.501e-14
Identity = 49/153 (32.03%), Postives = 81/153 (52.94%), Query Frame = -2
Query:  136 ISEKEMNRRKDMLANLRSKVNQMASTLN--MSNFANRDSLLGPEIK-SADVMNRATG----------LDNQGLVGFQRQIMREQDERLEKLEETVVSTKHIALAVNEELDLHTRLIDDLDQHVDVTDSRLRRVQKNLAILNKRTKGGCTCMCM 555
            I EKE+ RRK+ + +L S  NQ+ STL+  ++N + ++ L+G          NR  G           DNQ L   Q+ IMREQDE L+ L ++++  K++A A++ ELD H  ++DD++   D    RLR   + +  + +     C  +C+
Sbjct:   71 IQEKELLRRKNKVESLISMKNQLNSTLDAAINNTSQKNELMGNNNGVGIGYSNRQFGKPKETEATKQFDNQQLFTNQQHIMREQDESLDLLSQSIMRQKNMAHAMSNELDQHNEMLDDVEIGTDAVSMRLRNANRRMETIKQNAGSTCMIVCI 223          
The following BLAST results are available for this feature:
BLAST of CB304400 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SYP52_ARATH2.013e-7270.92Syntaxin-52 OS=Arabidopsis thaliana GN=SYP52 PE=1 ... [more]
SYP51_ARATH7.650e-7270.41Syntaxin-51 OS=Arabidopsis thaliana GN=SYP51 PE=1 ... [more]
STX8B_DICDI2.501e-1432.03Probable syntaxin-8B OS=Dictyostelium discoideum G... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIIaR_C09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIIaR_C09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304400 ID=CB304400|Name=CB304400|organism=Citrus sinensis|type=EST|length=661bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTGTCAGCAAGGGGGAAACAGTT
GCATTCACCATTGTGAGTTTTACAAGTATTTGATCAACATATATATGACC
ACAACCAGAGCAACGATTCCGATAACAGCTAAAAGCATGCACATACACGT
GCAACCACCCTTTGTGCGCTTATTCAAAATTGCCAGGTTCTTCTGCACTC
GCCGTAGGCGAGAATCTGTAACATCCACATGCTGGTCCAAGTCATCAATA
AGTCTAGTGTGCAGGTCAAGTTCTTCATTGACTGCCAATGCAATATGCTT
TGTACTGACTACTGTCTCCTCCAGTTTCTCAAGCCTTTCATCTTGCTCTC
TCATAATTTGCCGTTGAAAACCAACAAGGCCCTGATTGTCCAAGCCAGTT
GCTCGGTTCATGACATCGGCTGACTTTATCTCTGGTCCAAGCAGGCTATC
CCTATTAGCAAAGTTTGACATGTTCAACGTGGAAGCCATTTGATTCACTT
TGGATCTCAAATTAGCAAGCATGTCCTTCCGACGATTCATCTCTTTCTCC
GAAATGGGCTGCTTCCCGGGAAGCTTAGATAAAAGGGACTGCAAGCTATC
CAATCTGGTTCCTAATATGGTAATCTTCCTCCGTATGGCAGATGCATGAC
GCTGGGATTCA
back to top