CB304566
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB304566 vs. ExPASy Swiss-Prot
Match: AOC1_ARATH (Allene oxide cyclase 1, chloroplastic OS=Arabidopsis thaliana GN=AOC1 PE=1 SV=1) HSP 1 Score: 78.5666 bits (192), Expect = 1.121e-14 Identity = 40/61 (65.57%), Postives = 47/61 (77.05%), Query Frame = -1 Query: 142 QVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSSFVHPSPMAKACKPGAPVANFTD 321 QVKL+QLV+P KLFYTFYLKG+ DLP EL+G PV PS V P+P AKA KP V+NFT+ Sbjct: 194 QVKLQQLVYPTKLFYTFYLKGLANDLPLELIGTPVPPSKDVEPAPEAKALKPSGVVSNFTN 254
BLAST of CB304566 vs. ExPASy Swiss-Prot
Match: AOC4_ARATH (Allene oxide cyclase 4, chloroplastic OS=Arabidopsis thaliana GN=AOC4 PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 4.261e-14 Identity = 39/61 (63.93%), Postives = 47/61 (77.05%), Query Frame = -1 Query: 142 QVKLKQLVFPFKLFYTFYLKGIK-DLPGELMGKPVRPSSFVHPSPMAKACKPGAPVANFTD 321 QVKL+QLV+P KLFYTFYLKG+ DLP EL GK V PS V P+ A+A +PGA +ANFT+ Sbjct: 194 QVKLRQLVYPTKLFYTFYLKGVAADLPVELTGKHVEPSKEVKPAAEAQATQPGATIANFTN 254
BLAST of CB304566 vs. ExPASy Swiss-Prot
Match: AOC2_ARATH (Allene oxide cyclase 2, chloroplastic OS=Arabidopsis thaliana GN=AOC2 PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.115e-13 Identity = 36/61 (59.02%), Postives = 46/61 (75.41%), Query Frame = -1 Query: 142 QVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSSFVHPSPMAKACKPGAPVANFTD 321 QVKL+QLV+P KLFYTFYLKG+ DLP EL G PV PS + P+P AKA +P ++N+T+ Sbjct: 193 QVKLQQLVYPTKLFYTFYLKGLANDLPLELTGTPVPPSKDIEPAPEAKALEPSGVISNYTN 253
BLAST of CB304566 vs. ExPASy Swiss-Prot
Match: AOC3_ARATH (Allene oxide cyclase 3, chloroplastic OS=Arabidopsis thaliana GN=AOC3 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.711e-13 Identity = 37/61 (60.66%), Postives = 45/61 (73.77%), Query Frame = -1 Query: 142 QVKLKQLVFPFKLFYTFYLKGI-KDLPGELMGKPVRPSSFVHPSPMAKACKPGAPVANFTD 321 QVKL+QLV+P KLFYTFYLKG+ DLP EL G V PS V P+P AKA +P ++NFT+ Sbjct: 198 QVKLRQLVYPTKLFYTFYLKGLANDLPLELTGTAVTPSKDVKPAPEAKAMEPSGVISNFTN 258 The following BLAST results are available for this feature:
BLAST of CB304566 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB304566 ID=CB304566; Name=CB304566; organism=Citrus sinensis; type=EST; length=357bpback to top |