CB417365
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3E_SOYBN (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Glycine max GN=FAD3 PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.454e-15 Identity = 35/44 (79.55%), Postives = 38/44 (86.36%), Query Frame = 2 Query: 125 NGVVEKGDSFD--PAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 NG +KG SFD P+APPPFKI EIRA+IPKHCWVKNPWRSLSY Sbjct: 14 NGYQQKGSSFDFDPSAPPPFKIAEIRASIPKHCWVKNPWRSLSY 57
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3C_SOYBN (Omega-3 fatty acid desaturase, chloroplastic OS=Glycine max GN=FAD7 PE=2 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.346e-14 Identity = 40/74 (54.05%), Postives = 51/74 (68.92%), Query Frame = 2 Query: 41 RESSFHFSVS--LLAAAMEKERKLKNELNA-NGVV-EKGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 RE ++ VS L A++E+E+K + N NGV EK FDP APPPF + +IRA IPKHCWVK+PWRS+SY Sbjct: 55 RERNWGLKVSAPLRVASIEEEQKSVDLTNGTNGVEHEKLPEFDPGAPPPFNLADIRAAIPKHCWVKDPWRSMSY 128
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3C_SESIN (Omega-3 fatty acid desaturase, chloroplastic OS=Sesamum indicum GN=FAD7 PE=2 SV=1) HSP 1 Score: 73.9442 bits (180), Expect = 2.719e-13 Identity = 32/70 (45.71%), Postives = 45/70 (64.29%), Query Frame = 2 Query: 41 RESSFHFSVSLLAAAMEKERKLKNELNANGVVEKGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 RE ++ VS ++ E + +N+ V+ G+ FDP APPPFK+ +IR IPKHCWVK+PWRS+ Y Sbjct: 56 REKNWALRVSAPLRVLQVEEEEENK-EGERVINGGEEFDPGAPPPFKLSDIREAIPKHCWVKDPWRSMGY 124
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3C_RICCO (Omega-3 fatty acid desaturase, chloroplastic OS=Ricinus communis GN=FAD7A-1 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.033e-12 Identity = 34/67 (50.75%), Postives = 45/67 (67.16%), Query Frame = 2 Query: 62 SVSLLAAAMEKERKLKNELNANGVVE----KGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 +VS ++ ++ER+ NG+V KG+ FD APPPF + +IRA IPKHCWVKNPWRS+SY Sbjct: 73 NVSTVSGEDDRERE-----EFNGIVNVDEGKGEFFDAGAPPPFTLADIRAAIPKHCWVKNPWRSMSY 134
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3E_BRANA (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Brassica napus GN=FAD3 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.748e-12 Identity = 28/48 (58.33%), Postives = 37/48 (77.08%), Query Frame = 2 Query: 107 KNELNANGVVEKGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 ++ +N + K + FDP+A PPFKIG+IRA IPKHCWVK+P RS+SY Sbjct: 8 RSNVNGDSGARKEEGFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSY 55
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3C_BRANA (Omega-3 fatty acid desaturase, chloroplastic (Fragment) OS=Brassica napus GN=FAD7 PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11 Identity = 26/37 (70.27%), Postives = 30/37 (81.08%), Query Frame = 2 Query: 140 KGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 K FDP APPPF + +IRA IPKHCWVKNPW+S+SY Sbjct: 42 KTQRFDPGAPPPFNLADIRAAIPKHCWVKNPWKSMSY 78
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3C_ARATH (Omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD7 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 1.492e-11 Identity = 26/33 (78.79%), Postives = 29/33 (87.88%), Query Frame = 2 Query: 152 FDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 FDP APPPF + +IRA IPKHCWVKNPW+SLSY Sbjct: 88 FDPGAPPPFNLADIRAAIPKHCWVKNPWKSLSY 120
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3E_ARATH (Omega-3 fatty acid desaturase, endoplasmic reticulum OS=Arabidopsis thaliana GN=FAD3 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 1.949e-11 Identity = 31/59 (52.54%), Postives = 42/59 (71.19%), Query Frame = 2 Query: 74 LAAAMEKERKLKNELNANGVVEKGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 + AM++ + + A G +K + FDP+A PPFKIG+IRA IPKHCWVK+P RS+SY Sbjct: 1 MVVAMDQRTNVNGDPGA-GDRKKEERFDPSAQPPFKIGDIRAAIPKHCWVKSPLRSMSY 58
BLAST of CB417365 vs. ExPASy Swiss-Prot
Match: FAD3D_ARATH (Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic OS=Arabidopsis thaliana GN=FAD8 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.545e-11 Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 2 Query: 137 EKGDSFDPAAPPPFKIGEIRATIPKHCWVKNPWRSLSY 250 E + FDP APPPF + +IRA IPKHCWVKNPW S+SY Sbjct: 76 EDTERFDPGAPPPFNLADIRAAIPKHCWVKNPWMSMSY 113 The following BLAST results are available for this feature:
BLAST of CB417365 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 9
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB417365 ID=CB417365; Name=CB417365; organism=Citrus sinensis; type=EST; length=251bpback to top |