CF503970
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF503970 vs. ExPASy Swiss-Prot
Match: C3H24_ORYSJ (Zinc finger CCCH domain-containing protein 24 OS=Oryza sativa subsp. japonica GN=Os03g0698800 PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 5.170e-13 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 2 Query: 2 CWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEE 97 CWLHPAQYRTRLCKDGTSC+RRVCFFAHT +E Sbjct: 350 CWLHPAQYRTRLCKDGTSCNRRVCFFAHTTDE 381 HSP 2 Score: 66.2402 bits (160), Expect = 6.320e-11 Identity = 32/64 (50.00%), Postives = 43/64 (67.19%), Query Frame = 3 Query: 234 NPFSQPMSPSGNCNLQSSMMWPQPNVPTLNLPGSNIQXXXXXXXXXARDILPDNFSSLSDFDSQ 425 +PF+ PMSPSGN + S+ W QPNVPTL+LPGS++Q ARD+ D++S + D DSQ Sbjct: 425 SPFTPPMSPSGN-GMPPSLGWQQPNVPTLHLPGSSLQSSRLRTSLSARDMPADDYSLMQDIDSQ 487
BLAST of CF503970 vs. ExPASy Swiss-Prot
Match: C3H30_ARATH (Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana GN=At2g41900 PE=1 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 1.965e-12 Identity = 29/32 (90.62%), Postives = 29/32 (90.62%), Query Frame = 2 Query: 2 CWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEE 97 CWLHPAQYRTRLCKDGT C RRVCFFAHT EE Sbjct: 330 CWLHPAQYRTRLCKDGTGCARRVCFFAHTPEE 361
BLAST of CF503970 vs. ExPASy Swiss-Prot
Match: C3H56_ARATH (Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana GN=At5g12850 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 2.172e-11 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 CWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEE 97 CWLHPAQYRTRLCKDG C+RRVCFFAH EE Sbjct: 326 CWLHPAQYRTRLCKDGMGCNRRVCFFAHANEE 357
BLAST of CF503970 vs. ExPASy Swiss-Prot
Match: C3H66_ARATH (Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana GN=At5g58620 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.705e-11 Identity = 27/32 (84.38%), Postives = 28/32 (87.50%), Query Frame = 2 Query: 2 CWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEE 97 CWLHPAQYRTRLCKD T+C RRVCFFAH EE Sbjct: 278 CWLHPAQYRTRLCKDETNCSRRVCFFAHKPEE 309
BLAST of CF503970 vs. ExPASy Swiss-Prot
Match: C3H23_ARATH (Zinc finger CCCH domain-containing protein 23 OS=Arabidopsis thaliana GN=At2g25900 PE=2 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 6.320e-11 Identity = 25/38 (65.79%), Postives = 31/38 (81.58%), Query Frame = 2 Query: 2 CWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEEPPAIVC 115 CWLHP++YRT+ CKDGTSC RR+CFFAHT E+ + C Sbjct: 159 CWLHPSRYRTQPCKDGTSCRRRICFFAHTTEQLRVLPC 196 The following BLAST results are available for this feature:
BLAST of CF503970 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF503970 ID=CF503970; Name=CF503970; organism=Citrus sinensis; type=EST; length=434bpback to top |