CF510195
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRK44_ARATH (WRKY transcription factor 44 OS=Arabidopsis thaliana GN=WRKY44 PE=1 SV=2) HSP 1 Score: 79.7221 bits (195), Expect = 4.991e-15 Identity = 37/53 (69.81%), Postives = 40/53 (75.47%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEM----PLRSTTPVTS 338 RSYYRCT+ C+ RKHVERASDDPRAFITTYEGKHNH + P ST P S Sbjct: 369 RSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHHLLLSPPSSSTLPFNS 421
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRKY3_ARATH (Probable WRKY transcription factor 3 OS=Arabidopsis thaliana GN=WRKY3 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.097e-13 Identity = 30/45 (66.67%), Postives = 37/45 (82.22%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMPLRSTT 326 RSYY+CT P C VRKHVERA+ DP+A +TTYEGKHNH++P T+ Sbjct: 435 RSYYKCTTPDCGVRKHVERAATDPKAVVTTYEGKHNHDVPAARTS 479
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRKY4_ARATH (Probable WRKY transcription factor 4 OS=Arabidopsis thaliana GN=WRKY4 PE=1 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 4.672e-13 Identity = 29/40 (72.50%), Postives = 35/40 (87.50%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYY+CT P C VRKHVERA+ DP+A +TTYEGKHNH++P Sbjct: 429 RSYYKCTTPGCGVRKHVERAATDPKAVVTTYEGKHNHDLP 468
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRK58_ARATH (Probable WRKY transcription factor 58 OS=Arabidopsis thaliana GN=WRKY58 PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 7.969e-13 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYY+CT P C VRKHVERAS D +A ITTYEGKHNH++P Sbjct: 326 RSYYKCTTPNCTVRKHVERASTDAKAVITTYEGKHNHDVP 365
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRKY2_ARATH (Probable WRKY transcription factor 2 OS=Arabidopsis thaliana GN=WRKY2 PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 8.811e-12 Identity = 29/40 (72.50%), Postives = 34/40 (85.00%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYY+CT P C VRKHVERAS D ++ ITTYEGKHNH++P Sbjct: 507 RSYYKCTAPGCTVRKHVERASHDLKSVITTYEGKHNHDVP 546
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRK33_ARATH (Probable WRKY transcription factor 33 OS=Arabidopsis thaliana GN=WRKY33 PE=1 SV=2) HSP 1 Score: 68.5514 bits (166), Expect = 1.151e-11 Identity = 30/40 (75.00%), Postives = 33/40 (82.50%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYY+CT C VRKHVERAS D RA ITTYEGKHNH++P Sbjct: 382 RSYYKCTTIGCPVRKHVERASHDMRAVITTYEGKHNHDVP 421
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRK20_ARATH (Probable WRKY transcription factor 20 OS=Arabidopsis thaliana GN=WRKY20 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 1.151e-11 Identity = 29/40 (72.50%), Postives = 34/40 (85.00%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYY+CT C VRKHVERAS DP+A ITTYEGKH+H++P Sbjct: 401 RSYYKCTAHGCPVRKHVERASHDPKAVITTYEGKHDHDVP 440
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRKY1_ARATH (WRKY transcription factor 1 OS=Arabidopsis thaliana GN=WRKY1 PE=1 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.563e-11 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMP 311 RSYYRC++P C V+KHVER+S D + ITTYEGKH+H+MP Sbjct: 327 RSYYRCSSPGCPVKKHVERSSHDTKLLITTYEGKHDHDMP 366
BLAST of CF510195 vs. ExPASy Swiss-Prot
Match: WRK26_ARATH (Probable WRKY transcription factor 26 OS=Arabidopsis thaliana GN=WRKY26 PE=2 SV=2) HSP 1 Score: 65.855 bits (159), Expect = 7.459e-11 Identity = 29/47 (61.70%), Postives = 34/47 (72.34%), Query Frame = 3 Query: 192 RSYYRCTNPKCKVRKHVERASDDPRAFITTYEGKHNHEMPLRSTTPV 332 RSYY+CT C VRKHVERA DP++ ITTYEGKH H++P PV Sbjct: 254 RSYYKCTFTGCFVRKHVERAFQDPKSVITTYEGKHKHQIPTPRRGPV 300 The following BLAST results are available for this feature:
BLAST of CF510195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 9
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF510195 ID=CF510195; Name=CF510195; organism=Citrus sinensis; type=EST; length=338bpback to top |