CF832642
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832642 vs. ExPASy Swiss-Prot
Match: BIP2_TOBAC (Luminal-binding protein 2 (Fragment) OS=Nicotiana tabacum GN=BIP2 PE=2 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 7.607e-11 Identity = 30/32 (93.75%), Postives = 31/32 (96.88%), Query Frame = -1 Query: 254 DYEEKLKEVEAVCNPIITAVYQRSGGAPGAGT 349 DYEEKLKEVEAVCNPIITAVYQRSGGAPG G+ Sbjct: 248 DYEEKLKEVEAVCNPIITAVYQRSGGAPGGGS 279
BLAST of CF832642 vs. ExPASy Swiss-Prot
Match: BIP2_ARATH (Luminal-binding protein 2 OS=Arabidopsis thaliana GN=At5g42020 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 9.935e-11 Identity = 30/33 (90.91%), Postives = 32/33 (96.97%), Query Frame = -1 Query: 251 DYEEKLKEVEAVCNPIITAVYQRSGGAPGAGTE 349 +Y+EKLKEVEAVCNPIITAVYQRSGGAPGAG E Sbjct: 623 EYDEKLKEVEAVCNPIITAVYQRSGGAPGAGGE 655
BLAST of CF832642 vs. ExPASy Swiss-Prot
Match: BIP1_TOBAC (Luminal-binding protein 1 (Fragment) OS=Nicotiana tabacum GN=BIP1 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.935e-11 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = -1 Query: 254 DYEEKLKEVEAVCNPIITAVYQRSGGAPGAGT 349 DYEEKLKEVEA+CNPIITAVYQRSGGAPG G+ Sbjct: 248 DYEEKLKEVEAICNPIITAVYQRSGGAPGGGS 279 The following BLAST results are available for this feature:
BLAST of CF832642 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832642 ID=CF832642; Name=CF832642; organism=Citrus sinensis; type=EST; length=349bpback to top |