CK932773
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBL1_ORYSJ (Ubiquitin-like protein 1 OS=Oryza sativa subsp. japonica GN=UBL1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_WHEAT (Ubiquitin OS=Triticum aestivum PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_TRYCR (Ubiquitin OS=Trypanosoma cruzi PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_SOYBN (Ubiquitin OS=Glycine max GN=SUBI-1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLTU (Ubiquitin OS=Solanum tuberosum GN=UBI3 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_SOLLC (Ubiquitin OS=Solanum lycopersicum GN=UBI3 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_PETCR (Ubiquitin OS=Petroselinum crispum GN=PCUBI4-1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_PEA (Ubiquitin OS=Pisum sativum GN=PU1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_ORYSJ (Ubiquitin OS=Oryza sativa subsp. japonica GN=UBQ1 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76
BLAST of CK932773 vs. ExPASy Swiss-Prot
Match: UBIQ_NICSY (Ubiquitin OS=Nicotiana sylvestris GN=UBICEP52-7 PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 3.939e-12 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 3 Query: 3 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 104 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG Sbjct: 43 LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 76 The following BLAST results are available for this feature:
BLAST of CK932773 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CK932773 ID=CK932773; Name=CK932773; organism=Citrus sinensis; type=EST; length=397bpback to top |