CK934084

Overview
NameCK934084
Unique NameCK934084
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length906
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: U172_ARATH (UPF0172 protein At5g55940 OS=Arabidopsis thaliana GN=EMB2731 PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.645e-82
Identity = 148/201 (73.63%), Postives = 173/201 (86.07%), Query Frame = 2
Query:   86 GELKYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQXXXXXXXXXXXISKDWLNPDLF 688
            GELKYE+SQNAYIKLVLH+ +HKTAAVNGVL+GR+SP++D VVEI+DSVPLFHS+L LLP LEISLIMIEEHY AQGL IVGYFHANERFDD+EL  +AKNIG+HI RYFPQ  +LLL+NKKLEAL KGK+RSPVMQL ++DASKNW++VG+DGG +LL KEP+ANVVL DYISSEKW+           ++KDWLNP LF
Sbjct:    7 GELKYEISQNAYIKLVLHSLRHKTAAVNGVLVGRISPKDDGVVEISDSVPLFHSNLALLPPLEISLIMIEEHYVAQGLSIVGYFHANERFDDVELCGVAKNIGDHISRYFPQAPILLLNNKKLEALSKGKERSPVMQLCVKDASKNWRVVGADGGSKLLLKEPSANVVLSDYISSEKWKDVTDVDDHLDDVTKDWLNPGLF 207          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: F158A_RAT (UPF0172 protein FAM158A OS=Rattus norvegicus GN=Fam158a PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.585e-19
Identity = 52/129 (40.31%), Postives = 75/129 (58.14%), Query Frame = 2
Query:   83 MGELKYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 469
            MGE+  E+S  AY K+ LHA ++  AAVNG+LL   +   + +  + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   DD     +A  I   I  +FP   +++LDNKKL   P+
Sbjct:    1 MGEV--EISARAYGKMCLHASRYPHAAVNGLLLAPATRSGECLC-LTDCVPLFHSHLALSVMLEVALNQVDVWATQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPNAVLIMLDNKKLVTWPR 126          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: F158A_MOUSE (UPF0172 protein FAM158A OS=Mus musculus GN=Fam158a PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 2.585e-19
Identity = 52/129 (40.31%), Postives = 76/129 (58.91%), Query Frame = 2
Query:   83 MGELKYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 469
            MGE+  E+S  AY K+ LHA ++  AAVNG+LL   +   + +  + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   DD     +A  I   I  +FP+  +++LDNKKL   P+
Sbjct:    1 MGEV--EISARAYGKMCLHASRYPHAAVNGLLLAPATGSGECLC-LTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAVLDDQSPGPLALKIAGRIAEFFPRAVLIMLDNKKLVTRPR 126          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: F158A_HUMAN (UPF0172 protein FAM158A OS=Homo sapiens GN=FAM158A PE=2 SV=3)

HSP 1 Score: 93.5893 bits (231), Expect = 1.675e-18
Identity = 50/129 (38.76%), Postives = 77/129 (59.69%), Query Frame = 2
Query:   83 MGELKYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPK 469
            MGE+  E+S  AY+K+ LHA ++  AAVNG+ L   +P++   + + D VPLFHSHL L   LE++L  ++   +  GL + GY+HAN   +D     +A  I   I  +FP   +++LDN+KL   P+
Sbjct:    1 MGEV--EISALAYVKMCLHAARYPHAAVNGLFLAP-APRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPR 126          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: U172_DROME (UPF0172 protein CG3501 OS=Drosophila melanogaster GN=CG3501 PE=1 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.783e-16
Identity = 46/118 (38.98%), Postives = 70/118 (59.32%), Query Frame = 2
Query:   98 YELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSI-AKNIGNHICRYFPQCAVLLLDNK 448
            Y++S+ AY KL+ HA K+   AVNG+LL   + +   V EI D++PLFH  L + P  E++L++I+ H   +GL I GY+ A E F D ++D   A  I + I   F     +++DNK
Sbjct:    4 YKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQV-EIVDAIPLFHQCLYVTPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAKIADKIQENFKNACFVVVDNK 120          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: CX4NB_MOUSE (Neighbor of COX4 OS=Mus musculus GN=Cox4nb PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.045e-15
Identity = 55/204 (26.96%), Postives = 92/204 (45.10%), Query Frame = 2
Query:  101 ELSQNAYIKLVLHARKHKTAAVNGVLLG-RVSPQND------AVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQXXXXXXXXXXXISKDWLNPDLFK 691
            +L+  AY K+VLH  K+   AVNG+L+  R  P+ +      +     D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K          +P + +Y +  ++ W+    D         P A  +    + S  ++           I  DW NP++ K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGSHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFGDAALIMVDNAKFTM----DCAAPTIHVYEQHENR-WRC--RDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRSDWTNPEINK 201          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: CX4NB_RAT (Neighbor of COX4 OS=Rattus norvegicus GN=Cox4nb PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.588e-15
Identity = 55/204 (26.96%), Postives = 91/204 (44.61%), Query Frame = 2
Query:  101 ELSQNAYIKLVLHARKHKTAAVNGVLLG-RVSPQNDAV------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQXXXXXXXXXXXISKDWLNPDLFK 691
            +L+  AY K+VLH  K+   AVNG+L+  R  P+ +            D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K          +P + +Y +  ++ W+    D         P A  +    + S  ++           I  DW NP++ K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAERQRPRKEHPPGAGNHTLFVDCIPLFHGTLALTPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDAALIMVDNAKFTM----DCAAPTIHVYEQHENR-WRC--RDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRSDWTNPEINK 201          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: CX4NB_HUMAN (Neighbor of COX4 OS=Homo sapiens GN=COX4NB PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 3.270e-14
Identity = 54/207 (26.09%), Postives = 91/207 (43.96%), Query Frame = 2
Query:  101 ELSQNAYIKLVLHARKHKTAAVNGVLLG-RVSPQNDAV---------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQXXXXXXXXXXXISKDWLNPDLFK 691
            +L+  AY K+VLH  K+   AVNG+L+  +  P+ + +             D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K          +P + +Y    ++ W+    D         P A  +    + S  ++           I  DW NP++ K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTM----DCVAPTIHVYEHHENR-WRC--RDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINK 204          
BLAST of CK934084 vs. ExPASy Swiss-Prot
Match: CX4NB_BOVIN (Neighbor of COX4 OS=Bos taurus GN=COX4NB PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 9.514e-14
Identity = 54/207 (26.09%), Postives = 90/207 (43.48%), Query Frame = 2
Query:  101 ELSQNAYIKLVLHARKHKTAAVNGVLLG-RVSPQNDAV---------VEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQXXXXXXXXXXXISKDWLNPDLFK 691
            +L+  AY K+VLH  K+   AV+G+L+  +  P+ + +             D +PLFH  L L P LE++L +I+         I GY+ ANER  D   + +A+ + + I   F   A++++DN K           P + +Y    +K W+    D         P A  +    + S  ++           I  DW NP++ K
Sbjct:    5 KLTTQAYCKMVLHGAKYPHCAVDGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDNSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTM----DCVVPTIHVYEHHENK-WRC--RDPHYDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINK 204          
The following BLAST results are available for this feature:
BLAST of CK934084 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
U172_ARATH1.645e-8273.63UPF0172 protein At5g55940 OS=Arabidopsis thaliana ... [more]
F158A_RAT2.585e-1940.31UPF0172 protein FAM158A OS=Rattus norvegicus GN=Fa... [more]
F158A_MOUSE2.585e-1940.31UPF0172 protein FAM158A OS=Mus musculus GN=Fam158a... [more]
F158A_HUMAN1.675e-1838.76UPF0172 protein FAM158A OS=Homo sapiens GN=FAM158A... [more]
U172_DROME7.783e-1638.98UPF0172 protein CG3501 OS=Drosophila melanogaster ... [more]
CX4NB_MOUSE5.045e-1526.96Neighbor of COX4 OS=Mus musculus GN=Cox4nb PE=1 SV... [more]
CX4NB_RAT6.588e-1526.96Neighbor of COX4 OS=Rattus norvegicus GN=Cox4nb PE... [more]
CX4NB_HUMAN3.270e-1426.09Neighbor of COX4 OS=Homo sapiens GN=COX4NB PE=1 SV... [more]
CX4NB_BOVIN9.514e-1426.09Neighbor of COX4 OS=Bos taurus GN=COX4NB PE=2 SV=1[more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004541_E05 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10001_IIIF_E05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934084 ID=CK934084|Name=CK934084|organism=Citrus sinensis|type=EST|length=906bp
GGGGAGATACTTGTGTGCTTGATCGGCGATTCCGATAAATTTTCAGCAAC
CCAGTGATCACTCACAGAAAAATACGAAAATTATGGGCGAGTTGAAATAC
GAATTGTCACAAAACGCATACATAAAGCTAGTGCTGCACGCGCGAAAGCA
CAAGACGGCGGCGGTCAACGGAGTCCTTCTGGGACGAGTCTCTCCTCAAA
ACGATGCTGTCGTCGAGATCGCCGACTCCGTCCCTCTCTTTCATTCCCAC
CTGGGCCTTCTCCCCAATCTCGAGATCTCCCTCATCATGATAGAAGAGCA
TTATAGTGCTCAGGGTCTTGGCATTGTGGGGTATTTTCATGCAAATGAGA
GGTTTGATGACTTGGAGCTTGATAGCATTGCTAAGAATATTGGCAATCAC
ATTTGCCGGTACTTTCCTCAATGTGCTGTTCTCTTGTTAGATAACAAAAA
GCTCGAAGCCTTACCCAAGGGGAAAGACCGGAGTCCTGTTATGCAGCTTT
ACATAAGGGATGCATCCAAGAACTGGAAGCTAGTTGGATCTGATGGTGGC
TGTCAATTGCTAACTAAGGAGCCTGCGGCAAATGTTGTTTTAATGGATTA
TATTTCTTCAGAGAAGTGGCAGGATGTTGTAGATTTTGATGATCACCTTG
ATGACATTAGCAAGGACTGGCTGAACCCTGACCTTTTCAAATGAGATTGT
CCATGGCCGTCAGTATTTTTGCCCTCCACAAGACTGATAGTAGTTAATAC
TGATGATGACATATATTTACCTATGGTCTGAGACATGGTGAACATGAAAG
GAAAATTTGTCAAATCGAGTTTCTTGTTTTGCTAAGAAGTTTTTGTATTT
TTAAGCTGTTCTGTTGCATCAACNNNTGCTTTGGATTACATTATGAAGTT
CCCGGA
back to top