CK934222

Overview
NameCK934222
Unique NameCK934222
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length378
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_SINAL (DNA-directed RNA polymerase subunit beta' OS=Sinapis alba GN=rpoC1 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 3.524e-16
Identity = 40/53 (75.47%), Postives = 44/53 (83.02%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDRNFDFTDSKYETVIP 184
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCDV FDRN +F+ ++  T  P
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDVCFDRNPNFSFARPITKKP 163          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_SOLTU (DNA-directed RNA polymerase subunit beta' OS=Solanum tuberosum GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 4.308e-14
Identity = 35/43 (81.40%), Postives = 36/43 (83.72%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDRNFDF 154
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD+    NF F
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDIESYPNFSF 153          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_CITSI (DNA-directed RNA polymerase subunit beta' OS=Citrus sinensis GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.308e-14
Identity = 35/40 (87.50%), Postives = 35/40 (87.50%), Query Frame = 2
Query:   23 GCXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            GC  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  110 GCPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_VITVI (DNA-directed RNA polymerase subunit beta' OS=Vitis vinifera GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_TOBAC (DNA-directed RNA polymerase subunit beta' OS=Nicotiana tabacum GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  110 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 148          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_SOLLC (DNA-directed RNA polymerase subunit beta' OS=Solanum lycopersicum GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_SOLBU (DNA-directed RNA polymerase subunit beta' OS=Solanum bulbocastanum GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_RANMC (DNA-directed RNA polymerase subunit beta' OS=Ranunculus macranthus GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_PIPCE (DNA-directed RNA polymerase subunit beta' OS=Piper cenocladum GN=rpoC1 PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
BLAST of CK934222 vs. ExPASy Swiss-Prot
Match: RPOC1_PANGI (DNA-directed RNA polymerase subunit beta' OS=Panax ginseng GN=rpoC1 PE=3 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 2.138e-13
Identity = 34/39 (87.18%), Postives = 34/39 (87.18%), Query Frame = 2
Query:   26 CXXTHVWYLKRLPSYIANLLDKPLKELEGLVYCDV*FDR 142
            C  THVWYLKRLPSYIANLLDKPLKELEGLVYCD  F R
Sbjct:  111 CPVTHVWYLKRLPSYIANLLDKPLKELEGLVYCDFSFAR 149          
The following BLAST results are available for this feature:
BLAST of CK934222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 88
Match NameE-valueIdentityDescription
RPOC1_SINAL3.524e-1675.47DNA-directed RNA polymerase subunit beta' OS=Sinap... [more]
RPOC1_SOLTU4.308e-1481.40DNA-directed RNA polymerase subunit beta' OS=Solan... [more]
RPOC1_CITSI4.308e-1487.50DNA-directed RNA polymerase subunit beta' OS=Citru... [more]
RPOC1_VITVI2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Vitis... [more]
RPOC1_TOBAC2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Nicot... [more]
RPOC1_SOLLC2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Solan... [more]
RPOC1_SOLBU2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Solan... [more]
RPOC1_RANMC2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Ranun... [more]
RPOC1_PIPCE2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Piper... [more]
RPOC1_PANGI2.138e-1387.18DNA-directed RNA polymerase subunit beta' OS=Panax... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004261_G09 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IVF_G09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934222 ID=CK934222|Name=CK934222|organism=Citrus sinensis|type=EST|length=378bp
GCGGGGGGATACATAAAACTGTGGATGCCNNNTAACCCACGTGTGGTATT
TGAAACGTCTTCCTAGTTATATCGCGAATCTTTTAGATAAACCTCTTAAA
GAATTAGAAGGCCTAGTATATTGCGATGTGTGATTTGATCGAAATTTTGA
TTTTACAGATTCGAAATATGAAACTGTCATCCCAGGCAATCGAATTGGGA
TGCCCTGAACCTGACATGTCTCTTTGGAGGAGTCACATGAAGCTCAGACC
GATGGGTGTATTCAATACTCCCCCCAAAAACGAAAAAGGGGAATTGGTCT
ATGGGCGATTCAGTAAAAAATAAATAAGAATTTCTAGTTGTACCTCGTGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top