EY736015
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY736015 vs. ExPASy Swiss-Prot
Match: LE14B_PRUAR (LEC14B homolog OS=Prunus armeniaca PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 4.581e-19 Identity = 26/39 (66.67%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 535 THYSGRGRFSPADCCHMLSRYLPVNGAWPVDHRSSQAYV 651 +++SGRGRFS AD CH+LSRYLP+NG W VD +S AYV Sbjct: 77 SNHSGRGRFSSADGCHVLSRYLPINGPWGVDQSTSPAYV 115 HSP 2 Score: 55.0694 bits (131), Expect = 4.581e-19 Identity = 30/73 (41.10%), Postives = 46/73 (63.01%), Query Frame = 2 Query: 317 SRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGRE 535 +RF ++ D+ + V + +S+ + + DHEIAQLTK +S P + S+++PGK L VST+KML GRE Sbjct: 5 TRFGKDNSACDSGNAVEGSGSSKGP-NEVSNDFDHEIAQLTKHRSRPHQLLSQDMPGKSRLLVSTMKMLVGRE 76
BLAST of EY736015 vs. ExPASy Swiss-Prot
Match: LE14B_LITER (LEC14B protein OS=Lithospermum erythrorhizon PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 1.155e-13 Identity = 46/109 (42.20%), Postives = 65/109 (59.63%), Query Frame = 2 Query: 302 MGYAMSRFEIESEFYDAADTVNQASNSRSKFKKPLSALDHEIAQLTKLKSEPKEHFSKEVPGKRHLPVSTVKMLAGRERIIQEEG-----------GSHLQIVVICLVD 595 MGYAMSRFE + ++ + ++ S+ S KP+ LDHEIAQLT+L+S P E+ S+++ KR LP+ST+KMLAGRE + G HL + C+VD Sbjct: 1 MGYAMSRFETDVSVIFSSSSDSETSHD-SLINKPVKNLDHEIAQLTRLRSAPHENLSRDLLVKRVLPLSTMKMLAGREANVSGRGRFSSADCCHVVSRHLPVNDPCVVD 108 The following BLAST results are available for this feature:
BLAST of EY736015 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY736015 ID=EY736015; Name=EY736015; organism=Citrus sinensis; type=EST; length=866bpback to top |