DN621426
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN621426 vs. ExPASy Swiss-Prot
Match: RBBP6_MOUSE (Retinoblastoma-binding protein 6 OS=Mus musculus GN=Rbbp6 PE=1 SV=5) HSP 1 Score: 68.5514 bits (166), Expect = 3.236e-11 Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 3 Query: 42 IRYKFRSSMNFDSVDIDGRLSVSVRDLKSMVVHNKKLNICHDFDLVFSDAVTGQEYNDENFQIPSGSSVIIKRVPAGSV 278 + YKF S +N+D+V DG L +S+ DLK ++ +KL D DL ++A T +EY D+N IP SSVI++R+P G V Sbjct: 4 VHYKFSSKLNYDTVTFDG-LHISLCDLKKQIMGREKLKAA-DSDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGV 80
BLAST of DN621426 vs. ExPASy Swiss-Prot
Match: RBBP6_HUMAN (Retinoblastoma-binding protein 6 OS=Homo sapiens GN=RBBP6 PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.236e-11 Identity = 35/79 (44.30%), Postives = 51/79 (64.56%), Query Frame = 3 Query: 42 IRYKFRSSMNFDSVDIDGRLSVSVRDLKSMVVHNKKLNICHDFDLVFSDAVTGQEYNDENFQIPSGSSVIIKRVPAGSV 278 + YKF S +N+D+V DG L +S+ DLK ++ +KL D DL ++A T +EY D+N IP SSVI++R+P G V Sbjct: 4 VHYKFSSKLNYDTVTFDG-LHISLCDLKKQIMGREKLKAA-DCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGV 80 The following BLAST results are available for this feature:
BLAST of DN621426 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DN621426 ID=DN621426; Name=DN621426; organism=Citrus sinensis; type=EST; length=644bpback to top |