DN617296

Overview
NameDN617296
Unique NameDN617296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length443
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12137 contig Csv1_Contig12137:31..473. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617296 vs. ExPASy Swiss-Prot
Match: C3H24_ARATH (Zinc finger CCCH domain-containing protein 24 OS=Arabidopsis thaliana GN=At2g28450 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.116e-50
Identity = 96/146 (65.75%), Postives = 115/146 (78.77%), Query Frame = 3
Query:    3 LPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRTPGKPLDVENLEVNISEVMLIVQVSSATFDDAVV 440
            LP+W++ SR+ GGL C LEGI+ SP+ NGYRNKCEFSVG SLQ KPTVGF LG+F  GVTAVEEPVDCPNVS+IA +YASIFQ+F++ S   VWNRF++SGFWRQLTVREGR PG   + E+    I+EVML+VQV     D+A V
Sbjct:  302 LPQWVLTSRDRGGLACNLEGIIESPITNGYRNKCEFSVGLSLQGKPTVGFSLGSFCAGVTAVEEPVDCPNVSKIASQYASIFQKFIENSKFQVWNRFQHSGFWRQLTVREGRKPGVFSNDEDAITRIAEVMLMVQVCLTGSDEAEV 447          
BLAST of DN617296 vs. ExPASy Swiss-Prot
Match: TRM2A_MOUSE (tRNA (uracil-5-)-methyltransferase homolog A OS=Mus musculus GN=Trmt2a PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.861e-13
Identity = 40/110 (36.36%), Postives = 59/110 (53.64%), Query Frame = 3
Query:    3 LPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKP-TVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVR 329
            LP  +++ ++     C LEG+  SP    YRNKCEF VG  +  K  TVG  LG ++ G  AV  P D  ++ E   +    FQEF++ +    ++    +G W+QLTVR
Sbjct:  200 LPWLLLQRQQHNKACCPLEGVKPSPQQTEYRNKCEFLVGVGVDGKDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVR 309          
BLAST of DN617296 vs. ExPASy Swiss-Prot
Match: TRM2A_HUMAN (tRNA (uracil-5-)-methyltransferase homolog A OS=Homo sapiens GN=TRMT2A PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 4.145e-13
Identity = 40/111 (36.04%), Postives = 58/111 (52.25%), Query Frame = 3
Query:   12 WIMKSREIGGLPC-KLEGILGSPLVNGYRNKCEFSVGYSLQAKP-TVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGR 338
            W+++ R      C  LEG+  SP    YRNKCEF VG  +  +  TVG  LG ++ G  AV  P D  ++ E   +    FQEF++ +    ++    +G W+QLTVR  R
Sbjct:  212 WLLEQRHKHNKACCPLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTPYSAYDPETYTGHWKQLTVRTSR 322          
BLAST of DN617296 vs. ExPASy Swiss-Prot
Match: TRM2_HUMAN (tRNA (uracil-5-)-methyltransferase homolog OS=Homo sapiens GN=TRMT2B PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.234e-13
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 3
Query:   42 LPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKP-TVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVR 329
            L C L  I+ SP++NGYRNK  FSV       P TVGF LG +R+G     +     N+ E   + A  ++ FL+QS L     F   G+WR+LTVR
Sbjct:  136 LSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNVVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVR 232          
BLAST of DN617296 vs. ExPASy Swiss-Prot
Match: TRM2_PONAB (tRNA (uracil-5-)-methyltransferase homolog OS=Pongo abelii GN=TRMT2B PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.206e-12
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 3
Query:   42 LPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKP-TVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVR 329
            L C L  I+ SP++NGYRNK  FSV       P TVGF LG +R+G     +     N+ E   + A  ++ FL+QS L     F   G+WR+LTVR
Sbjct:  118 LSCLLHPIIPSPVINGYRNKSTFSVNRGPDGNPKTVGFYLGTWRDGNMVCVQSNHLKNIPEKHSQVAQYYEVFLRQSPLEPCLVFHEGGYWRELTVR 214          
The following BLAST results are available for this feature:
BLAST of DN617296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
C3H24_ARATH1.116e-5065.75Zinc finger CCCH domain-containing protein 24 OS=A... [more]
TRM2A_MOUSE1.861e-1336.36tRNA (uracil-5-)-methyltransferase homolog A OS=Mu... [more]
TRM2A_HUMAN4.145e-1336.04tRNA (uracil-5-)-methyltransferase homolog A OS=Ho... [more]
TRM2_HUMAN9.234e-1341.24tRNA (uracil-5-)-methyltransferase homolog OS=Homo... [more]
TRM2_PONAB1.206e-1241.24tRNA (uracil-5-)-methyltransferase homolog OS=Pong... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A08_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617296 ID=DN617296|Name=DN617296|organism=Citrus sinensis|type=EST|length=443bp
CACTTCCAGAATGGATTATGAAATCAAGAGAGATAGGTGGTCTTCCATGT
AAACTAGAGGGAATACTTGGATCCCCACTTGTGAATGGATACCGTAACAA
GTGTGAGTTTTCTGTTGGATATTCTCTCCAGGCAAAACCAACTGTAGGAT
TCATGCTTGGAAACTTTAGGGAGGGTGTGACAGCAGTCGAAGAACCTGTG
GACTGCCCAAATGTATCAGAAATTGCTTGTAAATATGCTTCAATCTTTCA
GGAATTTCTGCAGCAATCAGACTTACCAGTTTGGAACAGATTCAAAAATA
GTGGATTCTGGCGCCAGTTAACGGTTCGAGAAGGAAGAACTCCAGGGAAG
CCATTGGATGTTGAGAATTTAGAGGTCAACATTTCAGAGGTCATGCTAAT
AGTACAGGTCTCCTCAGCGACCTTTGATGATGCAGTGGTAAAC
back to top