CK939292
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CK939292 vs. ExPASy Swiss-Prot
Match: APR1_ARATH (5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2) HSP 1 Score: 62.3882 bits (150), Expect = 1.674e-21 Identity = 32/43 (74.42%), Postives = 38/43 (88.37%), Query Frame = 2 Query: 419 AEVAEKVEGEE--DFEQFAKELENASPLEIMDRALEKFGNDIA 541 AE+AE+VE E DFE+ AK+LENASPLEIMD+ALEK+GNDIA Sbjct: 79 AEIAEEVEVVEIEDFEELAKKLENASPLEIMDKALEKYGNDIA 121 HSP 2 Score: 61.6178 bits (148), Expect = 1.674e-21 Identity = 32/50 (64.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 160 VSQIGSFRLVDRAHVASTSLS---QRRSLVRPLNAEPKRNDSVVPLAATL 300 VSQIGS RL+DR HVA SL+ +R S V+PLNAEPK DS++PLAAT+ Sbjct: 28 VSQIGSLRLLDRVHVAPVSLNLSGKRSSSVKPLNAEPKTKDSMIPLAATM 77
BLAST of CK939292 vs. ExPASy Swiss-Prot
Match: APR3_ARATH (5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2) HSP 1 Score: 60.4622 bits (145), Expect = 3.476e-13 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 2 Query: 419 AEVAEKVE--GEEDFEQFAKELENASPLEIMDRALEKFGNDIA 541 +EV EK++ EDFE+ AK LENASPLEIMD+ALEKFGNDIA Sbjct: 71 SEVTEKLDVVEVEDFEELAKRLENASPLEIMDKALEKFGNDIA 113 HSP 2 Score: 35.4242 bits (80), Expect = 3.476e-13 Identity = 21/48 (43.75%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 160 VSQIGSFRLVDRAHV--ASTSLSQRRSLVRPLNAEPKRNDSVVPLAAT 297 V++IGS RL++R +V AS SLS +RS V+ LN + +S+V T Sbjct: 27 VTKIGSLRLLNRTNVSAASLSLSGKRSSVKALNVQSITKESIVASEVT 74
BLAST of CK939292 vs. ExPASy Swiss-Prot
Match: APR2_ARATH (5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=2 SV=2) HSP 1 Score: 55.8398 bits (133), Expect = 2.166e-12 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 422 EVAEKVEGEEDFEQFAKELENASPLEIMDRALEKFGNDIA 541 EV EK EDFEQ AK+LE+ASPLEIMD+ALE+FG+ IA Sbjct: 74 EVEEKGGEVEDFEQLAKKLEDASPLEIMDKALERFGDQIA 113 HSP 2 Score: 37.3502 bits (85), Expect = 2.166e-12 Identity = 25/49 (51.02%), Postives = 30/49 (61.22%), Query Frame = 1 Query: 166 QIGSFRLVDRAHVASTSLSQRRSLVRPLNAEP-KRNDSVVPLAATLATP 309 QI S RL DR H LSQRR ++PLNAE R++S V A+TL P Sbjct: 30 QICSIRLSDRTH-----LSQRRYSMKPLNAESHSRSESWVTRASTLIAP 73 The following BLAST results are available for this feature:
BLAST of CK939292 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK939292 ID=CK939292; Name=CK939292; organism=Citrus sinensis; type=EST; length=689bpback to top |