EY665088
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 478 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 473 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 507
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 1.055e-12 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 1.377e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLEN+LRACVGLAPENNMILEYK Sbjct: 476 TPVVNALSKQRAMLENVLRACVGLAPENNMILEYK 510
BLAST of EY665088 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 1.799e-12 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 3 Query: 3 TPVVNALSKQRAMLENILRACVGLAPENNMILEYK 107 TPVVNALSKQRAMLENILRACVGLAPENNMI+EYK Sbjct: 476 TPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510 The following BLAST results are available for this feature:
BLAST of EY665088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY665088 ID=EY665088; Name=EY665088; organism=Citrus sinensis; type=EST; length=408bpback to top |