EH117793
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_SPIOL (Probable phospholipid hydroperoxide glutathione peroxidase OS=Spinacia oleracea PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.889e-15 Identity = 34/48 (70.83%), Postives = 40/48 (83.33%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 ++ IFDK+DVNG NAAPIYKFLKS KGG GD +KWNFTKFLV +D + Sbjct: 98 EYPIFDKVDVNGSNAAPIYKFLKSSKGGLFGDGLKWNFTKFLVDKDGN 145
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_MESCR (Probable phospholipid hydroperoxide glutathione peroxidase OS=Mesembryanthemum crystallinum GN=GPXMC1 PE=2 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.889e-15 Identity = 34/46 (73.91%), Postives = 39/46 (84.78%), Query Frame = -1 Query: 9 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQD 146 +F IFDK+DVNG NAAP+YK+LKS KGG GD IKWNFTKFLV +D Sbjct: 98 EFPIFDKVDVNGSNAAPVYKYLKSSKGGLFGDGIKWNFTKFLVDRD 143
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX2_ARATH (Probable glutathione peroxidase 2 OS=Arabidopsis thaliana GN=GPX2 PE=1 SV=1) HSP 1 Score: 80.1073 bits (196), Expect = 3.889e-15 Identity = 35/46 (76.09%), Postives = 41/46 (89.13%), Query Frame = -1 Query: 9 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQD 146 +F IFDK+DVNGKN AP+YK+LK+EKGG L DAIKWNFTKFLV+ D Sbjct: 95 EFPIFDKVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPD 140
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_TOBAC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana tabacum PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.633e-15 Identity = 33/48 (68.75%), Postives = 42/48 (87.50%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 ++ IFDK+DVNG NAAP+YKFLKS KGGF GD+IKWNF+KFLV ++ + Sbjct: 97 EYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGN 144
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_NICSY (Probable phospholipid hydroperoxide glutathione peroxidase OS=Nicotiana sylvestris PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.633e-15 Identity = 33/48 (68.75%), Postives = 42/48 (87.50%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 ++ IFDK+DVNG NAAP+YKFLKS KGGF GD+IKWNF+KFLV ++ + Sbjct: 97 EYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGN 144
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_GOSHI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Gossypium hirsutum PE=2 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 6.633e-15 Identity = 33/48 (68.75%), Postives = 42/48 (87.50%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 ++ IFDK+DVNG NAAP+YKFLKS KGGF GD+IKWNF+KFLV ++ + Sbjct: 98 EYPIFDKVDVNGDNAAPLYKFLKSSKGGFFGDSIKWNFSKFLVDKEGN 145
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX2_CAEEL (Probable glutathione peroxidase R05H10.5 OS=Caenorhabditis elegans GN=R05H10.5 PE=2 SV=1) HSP 1 Score: 77.7962 bits (190), Expect = 1.930e-14 Identity = 35/47 (74.47%), Postives = 40/47 (85.11%), Query Frame = -1 Query: 9 YQFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQD 149 ++ T+F KIDVNG N AP+YKFLK EKGGFL DAIKWNFTKFLV +D Sbjct: 89 FEPTLFQKIDVNGDNTAPLYKFLKQEKGGFLVDAIKWNFTKFLVGRD 135
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_SOLLC (Probable phospholipid hydroperoxide glutathione peroxidase OS=Solanum lycopersicum GN=GPXle-1 PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.292e-14 Identity = 31/46 (67.39%), Postives = 40/46 (86.96%), Query Frame = -1 Query: 9 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQD 146 ++ IFDK+DVNG NAAP+Y+FLKS KGGF GD IKWNF+KFL+ ++ Sbjct: 97 EYPIFDKVDVNGDNAAPLYRFLKSSKGGFFGDGIKWNFSKFLIDKE 142
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX6_ARATH (Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial OS=Arabidopsis thaliana GN=GPX6 PE=2 SV=2) HSP 1 Score: 75.8702 bits (185), Expect = 7.334e-14 Identity = 32/48 (66.67%), Postives = 38/48 (79.17%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 ++ IFDK+DVNG AAP+YKFLKS KGG GD IKWNF KFLV +D + Sbjct: 159 EYPIFDKVDVNGDKAAPVYKFLKSSKGGLFGDGIKWNFAKFLVDKDGN 206
BLAST of EH117793 vs. ExPASy Swiss-Prot
Match: GPX4_CITSI (Probable phospholipid hydroperoxide glutathione peroxidase OS=Citrus sinensis GN=CSA PE=1 SV=1) HSP 1 Score: 75.485 bits (184), Expect = 9.578e-14 Identity = 32/48 (66.67%), Postives = 40/48 (83.33%), Query Frame = -1 Query: 3 QFTIFDKIDVNGKNAAPIYKFLKSEKGGFLGDAIKWNFTKFLVTQDSS 146 +F IFDK+DVNG NAAP+YK LKS KGG GD+IKWNF+KFLV ++ + Sbjct: 95 EFPIFDKVDVNGDNAAPLYKHLKSSKGGLFGDSIKWNFSKFLVDKEGN 142 The following BLAST results are available for this feature:
BLAST of EH117793 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 19
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EH117793 ID=EH117793; Name=EH117793; organism=Citrus sinensis; type=EST; length=155bpback to top |