GE213315
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of GE213315 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2) HSP 1 Score: 91.6633 bits (226), Expect = 1.256e-18 Identity = 43/52 (82.69%), Postives = 46/52 (88.46%), Query Frame = -1 Query: 195 LIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPAFERSFGLFKPDLSAAY 350 LIAHLRSM GTPLMPGK VDTYIFALYDE+LKPGP+ ER+FGLFK DLS Y Sbjct: 290 LIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVY 341
BLAST of GE213315 vs. ExPASy Swiss-Prot
Match: E13L_TOBAC (Glucan endo-1,3-beta-glucosidase, acidic isoform GL153 OS=Nicotiana tabacum GN=GGL4 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 9.639e-11 Identity = 29/54 (53.70%), Postives = 39/54 (72.22%), Query Frame = -1 Query: 195 RYLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPAFERSFGLFKPDLSAAY 356 R LI H++ AGTP PGKS++TY+FA++DE++K G E+ FGLF PD A Y Sbjct: 285 RNLIDHVKRGAGTPKKPGKSIETYLFAMFDENVKKGEITEKHFGLFSPDQRAKY 338 The following BLAST results are available for this feature:
BLAST of GE213315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
|