DY257277
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY257277 vs. ExPASy Swiss-Prot
Match: UPL2_ARATH (E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=2) HSP 1 Score: 63.1586 bits (152), Expect = 5.995e-15 Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 2 Query: 356 DVKDISELTFHLNADKENHIQYEITDVTDYDLRPGGPNITVTDKT 490 DV DI +LTF ++AD+E HI YE T+VTDY+L+PGG NI VT++T Sbjct: 3442 DVSDILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEET 3486 HSP 2 Score: 36.5798 bits (83), Expect = 5.995e-15 Identity = 20/52 (38.46%), Postives = 27/52 (51.92%), Query Frame = 1 Query: 499 YVEHVTDHLLTQAFRPPILTFMECFKEPLPQESKTTTQELHAERQIRDLTYI 654 YV+ V DH+LT A RP I F+E E +P+E + + E I L I Sbjct: 3490 YVDLVADHILTSAIRPQINAFLEGLNELIPRELVSIFNDKELELLISGLPEI 3541
BLAST of DY257277 vs. ExPASy Swiss-Prot
Match: UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3) HSP 1 Score: 63.1586 bits (152), Expect = 7.787e-15 Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 2 Query: 356 DVKDISELTFHLNADKENHIQYEITDVTDYDLRPGGPNITVTDKT 490 DV DI +LTF ++AD+E HI YE T+VTDY+L+PGG NI VT++T Sbjct: 3465 DVSDILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEET 3509 HSP 2 Score: 36.1946 bits (82), Expect = 7.787e-15 Identity = 20/52 (38.46%), Postives = 27/52 (51.92%), Query Frame = 1 Query: 499 YVEHVTDHLLTQAFRPPILTFMECFKEPLPQESKTTTQELHAERQIRDLTYI 654 YV+ V H+LT A RP I F+E F E +P+E + + E I L I Sbjct: 3513 YVDLVAGHILTNAIRPQINAFLEGFNELIPRELVSIFNDKELELLISGLPEI 3564 The following BLAST results are available for this feature:
BLAST of DY257277 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY257277 ID=DY257277; Name=DY257277; organism=Citrus sinensis; type=EST; length=1266bpback to top |