CX287333
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 1.055e-20 Identity = 45/75 (60.00%), Postives = 58/75 (77.33%), Query Frame = 3 Query: 48 MGSRVTLRT---KGKGVKGAKASEEKSMIDSFKEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263 M S ++L+ KGKG KGA +S++KS D KEW+ W++KKAK THYGFIPL+I +GMNSDPKP ++QLLSPV Sbjct: 1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQLLSPV 75
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1) HSP 1 Score: 86.2705 bits (212), Expect = 5.416e-17 Identity = 41/77 (53.25%), Postives = 53/77 (68.83%), Query Frame = 3 Query: 48 MGSRVTLRTKGK-----GVKGAKASEEKSMIDSFKEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263 M ++ TL+ KGK G + +S S FK+W+ W+++KAK THYGFIPLIIIIGMNSDPKP ++ LLSPV Sbjct: 1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLFHLLSPV 77
BLAST of CX287333 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 85.1149 bits (209), Expect = 1.207e-16 Identity = 43/71 (60.56%), Postives = 52/71 (73.24%), Query Frame = 3 Query: 66 LRTKGKGVKGAKASEEK----SMIDSF-KEWSTWTMKKAKADTHYGFIPLIIIIGMNSDPKPQVYQLLSPV 263 L+ KGK K A A++E +++ F KEW TWT KKAK THYGFIPL+IIIGMNS+PKP + QLLSPV Sbjct: 2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQLLSPV 72 The following BLAST results are available for this feature:
BLAST of CX287333 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX287333 ID=CX287333; Name=CX287333; organism=Citrus clementina; type=EST; length=381bpback to top |