CX288694
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX288694 vs. ExPASy Swiss-Prot
Match: ACT3_SOYBN (Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 5.662e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3 Query: 9 LASLSTFQQMWISKGEYDESGPSIVHRKCF 98 LASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 347 LASLSTFQQMWISKGEYDESGPSIVHRKCF 376
BLAST of CX288694 vs. ExPASy Swiss-Prot
Match: ACT3_ORYSJ (Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 5.662e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3 Query: 9 LASLSTFQQMWISKGEYDESGPSIVHRKCF 98 LASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 348 LASLSTFQQMWISKGEYDESGPSIVHRKCF 377
BLAST of CX288694 vs. ExPASy Swiss-Prot
Match: ACT3_ORYSI (Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=2 SV=2) HSP 1 Score: 66.6254 bits (161), Expect = 5.662e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3 Query: 9 LASLSTFQQMWISKGEYDESGPSIVHRKCF 98 LASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 348 LASLSTFQQMWISKGEYDESGPSIVHRKCF 377
BLAST of CX288694 vs. ExPASy Swiss-Prot
Match: ACT2_DAUCA (Actin-2 OS=Daucus carota PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 5.662e-11 Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 3 Query: 9 LASLSTFQQMWISKGEYDESGPSIVHRKCF 98 LASLSTFQQMWISKGEYDESGPSIVHRKCF Sbjct: 352 LASLSTFQQMWISKGEYDESGPSIVHRKCF 381 The following BLAST results are available for this feature:
BLAST of CX288694 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX288694 ID=CX288694; Name=CX288694; organism=Citrus clementina; type=EST; length=461bpback to top |