CX289140
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX289140 vs. ExPASy Swiss-Prot
Match: NAC78_ARATH (NAC domain-containing protein 78 OS=Arabidopsis thaliana GN=NAC078 PE=2 SV=2) HSP 1 Score: 77.411 bits (189), Expect = 3.207e-14 Identity = 33/52 (63.46%), Postives = 42/52 (80.77%), Query Frame = 3 Query: 3 IGMKKTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKK 158 +GMKKTLV+H GRAP+G+RTNWVMHEYR + +DL Q A+VLCR+F+K Sbjct: 108 VGMKKTLVYHKGRAPRGERTNWVMHEYRLSDEDLKKAGVPQEAYVLCRIFQK 159
BLAST of CX289140 vs. ExPASy Swiss-Prot
Match: NAC7_ARATH (NAC domain-containing protein 7 OS=Arabidopsis thaliana GN=NAC007 PE=2 SV=2) HSP 1 Score: 67.3958 bits (163), Expect = 3.319e-11 Identity = 30/53 (56.60%), Postives = 44/53 (83.02%), Query Frame = 3 Query: 3 IGMKKTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQ 161 IGM+KTLVF+ GRAP G++++W+MHEYR TD+ +GT P + +V+CR+FKK+ Sbjct: 107 IGMRKTLVFYKGRAPNGQKSDWIMHEYRLETDE-NGT-PQEEGWVVCRVFKKR 157
BLAST of CX289140 vs. ExPASy Swiss-Prot
Match: NAC76_ORYSJ (NAC domain-containing protein 76 OS=Oryza sativa subsp. japonica GN=NAC76 PE=2 SV=2) HSP 1 Score: 65.855 bits (159), Expect = 9.657e-11 Identity = 29/53 (54.72%), Postives = 42/53 (79.25%), Query Frame = 3 Query: 3 IGMKKTLVFHMGRAPKGKRTNWVMHEYRATTDDLDGTKPGQSAFVLCRLFKKQ 161 IGM+KTLVF++GRAP GK+T+W+MHEYR D++D + G +V+CR+F K+ Sbjct: 111 IGMRKTLVFYVGRAPHGKKTDWIMHEYRLDQDNVDVQEDG---WVVCRVFMKK 160 The following BLAST results are available for this feature:
BLAST of CX289140 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX289140 ID=CX289140; Name=CX289140; organism=Citrus clementina; type=EST; length=462bpback to top |