CX292237
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX292237 vs. ExPASy Swiss-Prot
Match: ERF1Z_ARATH (Eukaryotic peptide chain release factor subunit 1-3 OS=Arabidopsis thaliana GN=ERF1-3 PE=2 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 8.602e-14 Identity = 35/43 (81.40%), Postives = 41/43 (95.35%), Query Frame = 1 Query: 34 HKSQEGSQFCRGFGGIGGILRYQLDMRSFDEFSDDGEIYDDSE 162 +KSQEGSQFCRGFGGIGG+LRYQLDMR+FDE S DGE+Y+DS+ Sbjct: 394 NKSQEGSQFCRGFGGIGGLLRYQLDMRTFDELS-DGEVYEDSD 435
BLAST of CX292237 vs. ExPASy Swiss-Prot
Match: ERF1Y_ARATH (Eukaryotic peptide chain release factor subunit 1-2 OS=Arabidopsis thaliana GN=ERF1-2 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 7.282e-13 Identity = 34/43 (79.07%), Postives = 40/43 (93.02%), Query Frame = 1 Query: 34 HKSQEGSQFCRGFGGIGGILRYQLDMRSFDEFSDDGEIYDDSE 162 +KSQEGSQFCRGFGGIGG+LRYQLDMR+FDE SD E+Y+DS+ Sbjct: 393 NKSQEGSQFCRGFGGIGGMLRYQLDMRTFDELSDT-EVYEDSD 434
BLAST of CX292237 vs. ExPASy Swiss-Prot
Match: ERF1X_ARATH (Eukaryotic peptide chain release factor subunit 1-1 OS=Arabidopsis thaliana GN=ERF1-1 PE=2 SV=2) HSP 1 Score: 68.9366 bits (167), Expect = 3.059e-11 Identity = 33/41 (80.49%), Postives = 36/41 (87.80%), Query Frame = 1 Query: 34 HKSQEGSQFCRGFGGIGGILRYQLDMRSFDEFSDDGEIYDD 156 +KSQEGSQFCRGFGGIGGILRYQLDM +FD S+DGE DD Sbjct: 395 NKSQEGSQFCRGFGGIGGILRYQLDMTAFD--SEDGEALDD 433 The following BLAST results are available for this feature:
BLAST of CX292237 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX292237 ID=CX292237; Name=CX292237; organism=Citrus clementina; type=EST; length=724bpback to top |