CX297883
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX297883 vs. ExPASy Swiss-Prot
Match: PAPA5_CARPA (Cysteine proteinase (Fragment) OS=Carica papaya PE=3 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 4.643e-21 Identity = 41/45 (91.11%), Postives = 45/45 (100.00%), Query Frame = 2 Query: 14 IRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA 148 IRLKEKPYW+IKNSWGE+WGENGYYKICRGRN+CGVDSMVST+AA Sbjct: 46 IRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAA 90
BLAST of CX297883 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 1.034e-20 Identity = 42/46 (91.30%), Postives = 45/46 (97.83%), Query Frame = 2 Query: 14 IRLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAAA 151 IRLKEKPYWIIKNSWG++WGE GYYKICRGRNVCGVDSMVST+AAA Sbjct: 314 IRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAA 359
BLAST of CX297883 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1) HSP 1 Score: 95.9005 bits (237), Expect = 6.704e-20 Identity = 39/46 (84.78%), Postives = 44/46 (95.65%), Query Frame = 2 Query: 17 RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAAAV 154 R KEKPYWIIKNSWGE+WGENG+YKIC+GRN+CGVDSMVST+AA V Sbjct: 318 RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATV 363
BLAST of CX297883 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2) HSP 1 Score: 95.9005 bits (237), Expect = 6.704e-20 Identity = 39/44 (88.64%), Postives = 44/44 (100.00%), Query Frame = 2 Query: 17 RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA 148 RLKEKPYWIIKNSWGESWGENG+YKIC+GRN+CGVDS+VST+AA Sbjct: 315 RLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAA 358
BLAST of CX297883 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 2.817e-18 Identity = 40/48 (83.33%), Postives = 44/48 (91.67%), Query Frame = 2 Query: 14 IRLKEKPYWIIKNSWGESWGENGYYKICRG---RNVCGVDSMVSTIAA 148 IRLK+KPYWIIKNSWGE+WGENGYYKICRG RN CGVDSMVST++A Sbjct: 318 IRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSA 365 The following BLAST results are available for this feature:
BLAST of CX297883 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 5
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX297883 ID=CX297883; Name=CX297883; organism=Citrus clementina; type=EST; length=396bpback to top |