CX299902
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1_ARATH (Mps one binder kinase activator-like 1 OS=Arabidopsis thaliana GN=At4g19045 PE=2 SV=1) HSP 1 Score: 106.686 bits (265), Expect = 5.473e-23 Identity = 51/56 (91.07%), Postives = 52/56 (92.86%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSIIVPY 168 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFT EF LIDKKEL PLQELI+SII PY Sbjct: 160 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTHEFVLIDKKELAPLQELIESIIAPY 215
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1A_DICDI (Mps one binder kinase activator-like 1 homolog A OS=Dictyostelium discoideum GN=mobA PE=3 SV=1) HSP 1 Score: 87.4261 bits (215), Expect = 3.436e-17 Identity = 41/53 (77.36%), Postives = 45/53 (84.91%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSII 159 AHIYHSHFQKIVSL EEAHLNT KHFI F EF L+DKKELGPL ELI+S++ Sbjct: 158 AHIYHSHFQKIVSLGEEAHLNTSLKHFIYFIQEFNLVDKKELGPLNELIESLM 210
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1B_DICDI (Mps one binder kinase activator-like 1 homolog B OS=Dictyostelium discoideum GN=mobB PE=3 SV=1) HSP 1 Score: 82.8037 bits (203), Expect = 8.464e-16 Identity = 37/51 (72.55%), Postives = 43/51 (84.31%), Query Frame = 1 Query: 4 HIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 HIY+SHF KIVSL EEAHLNTCFKHF F EF L+DKKE+ PLQ+LID++ Sbjct: 161 HIYYSHFTKIVSLGEEAHLNTCFKHFYFFIVEFNLVDKKEMLPLQDLIDNL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1A_MOUSE (Mps one binder kinase activator-like 1A OS=Mus musculus GN=Mobkl1a PE=1 SV=3) HSP 1 Score: 79.337 bits (194), Expect = 9.358e-15 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1A_HUMAN (Mps one binder kinase activator-like 1A OS=Homo sapiens GN=MOBKL1A PE=1 SV=3) HSP 1 Score: 79.337 bits (194), Expect = 9.358e-15 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOB1_DROME (Mps one binder kinase activator-like 1 OS=Drosophila melanogaster GN=mats PE=1 SV=1) HSP 1 Score: 79.337 bits (194), Expect = 9.358e-15 Identity = 35/52 (67.31%), Postives = 42/52 (80.77%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++V+L EEAHLNT FKHFI F EF LI+++EL PLQELID + Sbjct: 160 AHIYHQHFTEVVTLGEEAHLNTSFKHFIFFVQEFNLIERRELAPLQELIDKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1B_RAT (Mps one binder kinase activator-like 1B OS=Rattus norvegicus GN=Mobkl1b PE=1 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 1.222e-14 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1B_PONAB (Mps one binder kinase activator-like 1B OS=Pongo abelii GN=MOBKL1B PE=2 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 1.222e-14 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1B_MOUSE (Mps one binder kinase activator-like 1B OS=Mus musculus GN=Mobkl1b PE=1 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 1.222e-14 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211
BLAST of CX299902 vs. ExPASy Swiss-Prot
Match: MOL1B_HUMAN (Mps one binder kinase activator-like 1B OS=Homo sapiens GN=MOBKL1B PE=1 SV=4) HSP 1 Score: 78.9518 bits (193), Expect = 1.222e-14 Identity = 34/52 (65.38%), Postives = 41/52 (78.85%), Query Frame = 1 Query: 1 AHIYHSHFQKIVSLKEEAHLNTCFKHFILFTCEFGLIDKKELGPLQELIDSI 156 AHIYH HF ++ L+EEAHLNT FKHFI F EF LID++EL PLQELI+ + Sbjct: 160 AHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL 211 The following BLAST results are available for this feature:
BLAST of CX299902 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 13
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX299902 ID=CX299902; Name=CX299902; organism=Citrus clementina; type=EST; length=474bpback to top |