CX300528
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX300528 vs. ExPASy Swiss-Prot
Match: PSAK_MEDSA (Photosystem I reaction center subunit psaK, chloroplastic OS=Medicago sativa GN=PSAK PE=2 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 8.430e-15 Identity = 38/39 (97.44%), Postives = 38/39 (97.44%), Query Frame = 3 Query: 3 GLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLAC 119 GLAPSANRKATAGLKLE RDSGLQTGDPAGFTLADTLAC Sbjct: 71 GLAPSANRKATAGLKLETRDSGLQTGDPAGFTLADTLAC 109
BLAST of CX300528 vs. ExPASy Swiss-Prot
Match: PSAK_ARATH (Photosystem I reaction center subunit psaK, chloroplastic OS=Arabidopsis thaliana GN=PSAK PE=2 SV=2) HSP 1 Score: 77.7962 bits (190), Expect = 1.878e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 3 Query: 3 GLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLAC 119 GLAPSANRKATAGL+LE RDSGLQTGDPAGFTLADTLAC Sbjct: 71 GLAPSANRKATAGLRLEARDSGLQTGDPAGFTLADTLAC 109
BLAST of CX300528 vs. ExPASy Swiss-Prot
Match: PSAK_HORVU (Photosystem I reaction center subunit psaK, chloroplastic OS=Hordeum vulgare GN=PSAK PE=1 SV=1) HSP 1 Score: 77.411 bits (189), Expect = 2.453e-14 Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 3 Query: 3 GLAPSANRKATAGLKLEVRDSGLQTGDPAGFTLADTLAC 119 GLAPSANRKATAGLKLE R+SGLQTGDPAGFTLADTLAC Sbjct: 67 GLAPSANRKATAGLKLEARESGLQTGDPAGFTLADTLAC 105 The following BLAST results are available for this feature:
BLAST of CX300528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CX300528 ID=CX300528; Name=CX300528; organism=Citrus clementina; type=EST; length=319bpback to top |