CX308869

Overview
NameCX308869
Unique NameCX308869
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length480
Libraries
Library NameType
AbsLeaSub1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig234 contig Ccv1_Contig234:299..778. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RD23D_ARATH (Putative DNA repair protein RAD23-4 OS=Arabidopsis thaliana GN=RAD23-4 PE=2 SV=2)

HSP 1 Score: 74.3294 bits (181), Expect = 3.069e-13
Identity = 33/35 (94.29%), Postives = 34/35 (97.14%), Query Frame = 2
Query:   41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145
            MGFDRA+VLEVFFACNKNEELA NYLLDHMHEFED
Sbjct:  343 MGFDRAMVLEVFFACNKNEELAANYLLDHMHEFED 377          
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RD23C_ARATH (Putative DNA repair protein RAD23-3 OS=Arabidopsis thaliana GN=RAD23-3 PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.523e-12
Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 2
Query:   41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145
            MGF+RALVLEVFFACNKNEELA NYLLDHMHEFE+
Sbjct:  385 MGFERALVLEVFFACNKNEELAANYLLDHMHEFEE 419          
BLAST of CX308869 vs. ExPASy Swiss-Prot
Match: RAD23_ORYSJ (Probable DNA repair protein RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 4.900e-11
Identity = 29/35 (82.86%), Postives = 34/35 (97.14%), Query Frame = 2
Query:   41 MGFDRALVLEVFFACNKNEELAVNYLLDHMHEFED 145
            MGFDRALVL+VFFACNK+E+LA NYLLDHM+EF+D
Sbjct:  354 MGFDRALVLDVFFACNKDEQLAANYLLDHMNEFDD 388          
The following BLAST results are available for this feature:
BLAST of CX308869 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
RD23D_ARATH3.069e-1394.29Putative DNA repair protein RAD23-4 OS=Arabidopsis... [more]
RD23C_ARATH1.523e-1291.43Putative DNA repair protein RAD23-3 OS=Arabidopsis... [more]
RAD23_ORYSJ4.900e-1182.86Probable DNA repair protein RAD23 OS=Oryza sativa ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC21004G08Rv AbsLeaSub1 Citrus clementina cDNA clone C21004G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX308869 ID=CX308869|Name=CX308869|organism=Citrus clementina|type=EST|length=480bp
GCGGGCTGAGGAGAGAGAAGCTATCGAGCGTCTTGAAGCAATGGGCTTTG
ATCGTGCCCTAGTGTTGGAAGTGTTCTTTGCTTGCAACAAGAATGAGGAG
TTGGCAGTCAACTATCTCTTAGATCACATGCATGAGTTTGAGGATTGATT
GAAGTCACCCTTTTCTTGTTCTCCCCCTTTTTTTTTTTTTTTTCTTTTCC
ATGTTGGGCGCATATACTCTTGTGGTTAAACAGTGTCTTATACCAACTAT
ATGCTCTGTGGAGTCTGGAGAACACTTGTCAAGATGTTCATGTCGCTAGT
TTATCCTTGGACGCTAACATTTTCTCTATTTATTTCTCTTAAGATGTTTG
GTTATAAATTATCATACGCCAGTCTCCATTGGGATATATCTTTTCATTTC
TTGCCGTCCTTTCTTTAGTTTATCATTTGTAATCGATGTTCGGCTAGTCC
CATAAATGTTCTTTATAAAAATGTCGCCTC
back to top