DY257714

Overview
NameDY257714
Unique NameDY257714
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length1343
Libraries
Library NameType
AbsCOv1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: UPL3_ARATH (E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana GN=UPL3 PE=1 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 7.416e-131
Identity = 247/349 (70.77%), Postives = 274/349 (78.51%), Query Frame = 2
Query:    2 RVGLAMWRSNSSSENPPMEIDGDEGKSGKTSNISGDLVHAPLGLFPRPWPPSADASEGGQFSKVIEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDINNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPNTPSNGNGAFGISGRMTWPSVMTLG---QLPETFLPYSTK 1039
            +  L MWRS SS +   M+I  DE + GK S  + D+V APLGLFPRPWP +AD SEGGQF KVIEYFRLLGRVMAKALQDGRLLD+P STAFYKL+LG ELDLHDI+ FDAE GK LQEL V++ RK +LE +  DN     DL  RG  IEDL L+FTLPGYP+YIL+ GDE VDI NLEEYISLVVDATVK G+ RQ+EAFR+GFNQVFDITSLQIFTP ELD+LLCGRRELWE   LAEHIKFDHGY AKSPAI+NLLEIMGE T DQQRAFCQFVTGAPRLPPGGLAVL PKLTIVRKHSST+ +  +NG GA   +     PSVMT     +LP    PYSTK
Sbjct: 1526 KASLGMWRS-SSGDKVSMQIGRDEIEDGKPSAANRDIVLAPLGLFPRPWPSTADISEGGQFHKVIEYFRLLGRVMAKALQDGRLLDVPLSTAFYKLILGQELDLHDIVLFDAELGKTLQELRVVVARKHYLEGVGGDNSSTISDLCLRGCRIEDLSLEFTLPGYPEYILRSGDEIVDITNLEEYISLVVDATVKRGVTRQIEAFRSGFNQVFDITSLQIFTPSELDYLLCGRRELWEVETLAEHIKFDHGYNAKSPAIINLLEIMGELTADQQRAFCQFVTGAPRLPPGGLAVLNPKLTIVRKHSSTS-SAAANGAGA-SETADDDLPSVMTCANYLKLP----PYSTK 1867          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: UPL4_ARATH (E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis thaliana GN=UPL4 PE=2 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 2.425e-73
Identity = 163/324 (50.31%), Postives = 202/324 (62.35%), Query Frame = 2
Query:   83 GKTSNISGDLVHAPLGLFPRPWPPSADASEGGQFSKVIEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDEN--VDINNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPNTPSNGNGAFGISGRMTWPSVMTLG---QLPETFLPYSTK 1039
            GK    SG L  +  GLFPRPW  ++  S+      V++ F LLG V+AKALQDGR+LDLP S AFYKL+LG EL   DI   D E  K L EL  ++ RK+       D+     DL F G  IEDLCL+F LPGY DY L P   N  V+++NLEEYI  +V+ATV  GI +Q+EAFR+GFNQVF I  L+IF   EL+ +LCG  +L+    + +HIKFDHGYT+ SP +  LL+I+ EF  +QQRAF QFVTG+PRLP GGLA L PKLTIVRKH S + +T                PSVMT     +LP    PYS+K
Sbjct: 1183 GKPVEHSGVLASSS-GLFPRPWSGTSTTSD------VLQKFVLLGTVVAKALQDGRVLDLPLSKAFYKLILGQELSSFDIHFVDPELCKTLVELQALVRRKKLFAEAHGDSGAAKCDLSFHGTKIEDLCLEFALPGYTDYDLAPYSANDMVNLDNLEEYIKGIVNATVCNGIQKQVEAFRSGFNQVFSIEHLRIFNEEELETMLCGECDLFSMNEVLDHIKFDHGYTSSSPPVEYLLQILHEFDREQQRAFLQFVTGSPRLPHGGLASLSPKLTIVRKHGSDSSDT--------------DLPSVMTCANYLKLP----PYSSK 1481          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: TRIPC_HUMAN (Probable E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens GN=TRIP12 PE=1 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 1.171e-51
Identity = 128/319 (40.13%), Postives = 175/319 (54.86%), Query Frame = 2
Query:    2 RVGLAMWRSNSSSENPPMEIDGDEGKSGKTSNISGDLVHAPLGLFPRPWPPSADASEGGQFSKVIEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDL--HDIIPFDAEFGKILQELHVIICRKQHLE---SMTSDNCEEAVD-LRFRGAPIEDLCLDFTLPGYPDYILKPGDEN--VDINNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRR-ELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPN 931
            R  L +WR    + + P    G +  +    N+ G L   P G   +P             +KV   FR LG++MAKA+ D RL+DLP    FYK +L  E  L  HD+   D    + +  L  I+ +K+ LE   S T ++ + A++ L   G  +EDL LDFTLPG+P+  LK G ++  V I+NLEEY+ LV+   +  G+ RQ ++FR GF  VF ++ LQ F P ELD LLCG + + W+   L E  + DHGYT  S A+  L EI+  F  +QQR F QFVTG+PRLP GG   L P LTIVRK   +  N
Sbjct: 1644 RADLGLWRGEEVTLSNPK---GSQEGTKYIQNLQG-LFALPFGRTAKP----------AHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFDIDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFPNIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPEELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTGSPRLPVGGFRSLNPPLTIVRKTFESTEN 1948          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: YDE1_SCHPO (Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe GN=SPAC12B10.01c PE=2 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 4.043e-36
Identity = 96/268 (35.82%), Postives = 142/268 (52.99%), Query Frame = 2
Query:  113 VHAPLGLFPRPWPPSADASEGGQFSKVIEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDIN--NLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRK 910
            V+   GLFP P P    + E     + I  F  LG+ +A+++ D R++ + F+  F+   +   L +  +   D      L+ L  +I  K    + T        D++     +EDL LDFTLPG+P   L P   +  +   N+ +Y++ V+D TV  G+ +Q+EAF+ GF+ VF  TSLQ+ T HEL  L     E W  A L + I  DHGYT +SP I  LL +M +    +QR F QF+TG+ +LP GG A L P LT+VR+
Sbjct: 1347 VYQASGLFPSPIPLLGSSPEN---ERKISLFFALGQFVARSIYDSRIISIQFNPLFFARNI--PLTISSVAKVDKGLANSLRYLEKLIPGKNPTNAET--------DIK-----LEDLHLDFTLPGFPSIELIPDGASTPVTTFNVSDYLNYVIDYTVGKGVQQQLEAFQNGFSSVFPYTSLQVLTEHELVTLFGTVDEDWSYATLMKSIVADHGYTMESPTIQRLLTLMSQMNFQEQRDFLQFITGSRKLPIGGFAGLNPPLTVVRR 1596          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: UFD4_YEAST (Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae GN=UFD4 PE=1 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 5.839e-35
Identity = 108/336 (32.14%), Postives = 162/336 (48.21%), Query Frame = 2
Query:    2 RVGLAMWRSNSSSENPPMEIDGDEGKSGKTSNISGDLVHAPLGLFPRPWPPSADASEGGQFSKVIEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDI--IPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDIN--NLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPNTPSNGNGAFGISGRMTWPSVMT 997
            R  L MWR NS S    M++D  +              +    LFP P  P ++        KVIE F  LG  +A++L D R+LD  FS  F++L+  H +   ++  +P D E   ++ EL         ++ + + + +  V  +     +E L L FT+PG  D  L PG  N  +N  N+EEYI  V+D  +  GI +Q++AF  GF++VF    + I  P EL  +     E W  A L  ++  +HGYT  S  I + + I+  F   ++R F QF+TG+P+LP GG   L PK T+V KH+              G++     PSVMT
Sbjct: 1156 RKSLNMWRCNSYSYRSEMDVDTTDD-------------YITTLLFPEPLNPFSNNE------KVIELFGYLGTFVARSLLDNRILDFRFSKVFFELL--HRMSTPNVTTVPSDVETCLLMIEL---------VDPLLAKSLKYIVANKDDNMTLESLSLTFTVPGNDDIELIPGGCNKSLNSSNVEEYIHGVIDQILGKGIEKQLKAFIEGFSKVFSYERMLILFPDELVDIFGRVEEDWSMATLYTNLNAEHGYTMDSSIIHDFISIISAFGKHERRLFLQFLTGSPKLPIGGFKSLNPKFTVVLKHAED------------GLTADEYLPSVMT 1449          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: HECD1_HUMAN (E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 5.852e-27
Identity = 84/243 (34.57%), Postives = 127/243 (52.26%), Query Frame = 2
Query:  263 PFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHV----IICRKQHLESMTSDNCEEAVDLRFRGA----PIEDLCLDFT------LPGYPDYILKPG--DENVDINNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRE-LWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPNTPS 940
            P   A++  +L  E D   + P  A F K +++L +    I+  K   E   +   +E V     G+     IEDL L+F       + G+    LKP   DE + ++N EEY+ L+ D  + TGI +QMEAFR GFN+VF +  L  F+  E+  +LCG +   W    +  + +   GYT  SP  +  + ++   + D+++AF QF TG   LPPGGLA L P+LT+VRK  +T  + PS
Sbjct: 2336 PKPPAWFNGILTWE-DFELVNPHRARFLKEIKDLAIKRRQILSNKGLSEDEKNTKLQELVLKNPSGSGPPLSIEDLGLNFQFCPSSRIYGFTAVDLKPSGEDEMITMDNAEEYVDLMFDFCMHTGIQKQMEAFRDGFNKVFPMEKLSSFSHEEVQMILCGNQSPSWAAEDIINYTEPKLGYTRDSPGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPS 2577          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3)

HSP 1 Score: 107.842 bits (268), Expect = 1.492e-22
Identity = 86/279 (30.82%), Postives = 130/279 (46.59%), Query Frame = 2
Query:  194 IEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDI--NNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLIPKLTIVRKHSSTAPNTPSNGNGAFGISGRMTWPSVMTLGQLPETFL 1024
            + YF+ +GR++AKAL DG+LLD+ F+ +FYK +LG ++  HDI   D ++ K L+ L         LE+  SD     +DL F     E+  + +      DY LKPG  N+ +      EY+ LV    +   I  Q+ AF  GFN++     + IF   EL+ L+ G  E+ +   L  + ++   YTA SP I    E++  F+ +    F QFVTG  ++P  G   L       R     A   P     A     ++  P   +  QL E  L
Sbjct: 3405 LSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWL---------LENDVSD----ILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVAGHILTNAIRPQINAFLEGFNELIPRELVSIFNDKELELLISGLPEI-DFDDLKANTEYT-SYTAGSPVIHWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQGISGPQRLQIHKAYGAPERLPSAHTCFNQLDLPEYQSKEQLQERLL 3668          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: UPL2_ARATH (E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 3.323e-22
Identity = 76/232 (32.76%), Postives = 118/232 (50.86%), Query Frame = 2
Query:  194 IEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDI--NNLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRRELWEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVL 883
            + YF+ +GR++AKAL DG+LLD+ F+ +FYK +LG ++  HDI   D ++ K L+ L         LE+  SD     +DL F     E+  + +      DY LKPG  N+ +      EY+ LV D  + + I  Q+ AF  G N++     + IF   EL+ L+ G  E+ +   L  + ++   YT  SP I    E++  F+ +    F QFVTG  ++P  G   L
Sbjct: 3382 LSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTYHDIEAVDPDYYKNLKWL---------LENDVSD----ILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVADHILTSAIRPQINAFLEGLNELIPRELVSIFNDKELELLISGLPEI-DFDDLKANTEYT-SYTVGSPVIRWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKAL 3598          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: WWP2_MOUSE (NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus musculus GN=Wwp2 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 1.396e-20
Identity = 77/237 (32.49%), Postives = 116/237 (48.95%), Query Frame = 2
Query:  194 IEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDIN--NLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRREL----WEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLI 886
            + YFR +GR +A AL  G+ +D  F+  FYK +L     L D+   D EF        ++  ++ +LE       E  ++L F    I+D+ +   L     + LK G EN+ +   N EEYI L+ D     G+  Q +AF  GFN+V  +  L+ F   EL+ +LCG +E+    W+  A+  H      YT  S  I    +++ E   +++    QFVTG  RLP GG A LI
Sbjct:  602 LTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYN-----SIVWIKENNLE-------ECGLELFF----IQDMEI---LGKVTTHELKEGGENIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKNAIYRH------YTKSSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELI 813          
BLAST of DY257714 vs. ExPASy Swiss-Prot
Match: WWP2_HUMAN (NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens GN=WWP2 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 5.305e-20
Identity = 75/237 (31.65%), Postives = 116/237 (48.95%), Query Frame = 2
Query:  194 IEYFRLLGRVMAKALQDGRLLDLPFSTAFYKLVLGHELDLHDIIPFDAEFGKILQELHVIICRKQHLESMTSDNCEEAVDLRFRGAPIEDLCLDFTLPGYPDYILKPGDENVDIN--NLEEYISLVVDATVKTGIMRQMEAFRAGFNQVFDITSLQIFTPHELDHLLCGRREL----WEPAALAEHIKFDHGYTAKSPAIVNLLEIMGEFTPDQQRAFCQFVTGAPRLPPGGLAVLI 886
            + YFR +GR +A AL  G+ +D  F+  FYK +L     L D+   D EF        ++  ++ +LE       E  ++L F    I+D+ +   L     + LK G E++ +   N EEYI L+ D     G+  Q +AF  GFN+V  +  L+ F   EL+ +LCG +E+    W+ + +  H      YT  S  I    +++ E   +++    QFVTG  RLP GG A LI
Sbjct:  602 LTYFRFIGRFIAMALYHGKFIDTGFTLPFYKRMLNKRPTLKDLESIDPEFYN-----SIVWIKENNLE-------ECGLELYF----IQDMEI---LGKVTTHELKEGGESIRVTEENKEEYIMLLTDWRFTRGVEEQTKAFLDGFNEVAPLEWLRYFDEKELELMLCGMQEIDMSDWQKSTIYRH------YTKNSKQIQWFWQVVKEMDNEKRIRLLQFVTGTCRLPVGGFAELI 813          
The following BLAST results are available for this feature:
BLAST of DY257714 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
UPL3_ARATH7.416e-13170.77E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis th... [more]
UPL4_ARATH2.425e-7350.31E3 ubiquitin-protein ligase UPL4 OS=Arabidopsis th... [more]
TRIPC_HUMAN1.171e-5140.13Probable E3 ubiquitin-protein ligase TRIP12 OS=Hom... [more]
YDE1_SCHPO4.043e-3635.82Probable ubiquitin fusion degradation protein C12B... [more]
UFD4_YEAST5.839e-3532.14Ubiquitin fusion degradation protein 4 OS=Saccharo... [more]
HECD1_HUMAN5.852e-2734.57E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens... [more]
UPL1_ARATH1.492e-2230.82E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis th... [more]
UPL2_ARATH3.323e-2232.76E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis th... [more]
WWP2_MOUSE1.396e-2032.49NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Mus... [more]
WWP2_HUMAN5.305e-2031.65NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Hom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAB1AC01ZM1 AbsCOv1 Citrus clementina cDNA 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DY257714 ID=DY257714|Name=DY257714|organism=Citrus clementina|type=EST|length=1343bp
GAGAGTCGGACTTGCAATGTGGAGGTCAAATTCCTCATCAGAGAATCCGC
CAATGGAAATTGATGGGGATGAAGGCAAAAGTGGTAAAACCAGTAATATA
TCTGGAGATCTAGTTCATGCTCCTCTTGGGTTGTTCCCTCGACCTTGGCC
TCCTAGTGCTGATGCCTCTGAAGGTGGCCAGTTTAGTAAAGTTATTGAAT
ACTTCCGACTGCTTGGACGTGTAATGGCTAAAGCTCTTCAAGATGGGAGG
CTTTTAGACCTGCCATTTTCAACAGCATTCTACAAACTTGTTCTTGGTCA
CGAGCTTGATTTGCATGATATTATTCCCTTTGATGCCGAGTTTGGGAAGA
TTTTGCAAGAGTTGCATGTCATCATTTGTCGAAAACAACATTTAGAATCA
ATGACCTCTGATAATTGCGAAGAAGCTGTGGACTTGCGTTTTCGTGGGGC
CCCGATTGAAGATCTTTGCCTGGATTTTACTCTTCCTGGTTATCCAGACT
ATATTTTGAAACCAGGAGATGAAAATGTTGACATTAATAACTTGGAGGAA
TACATATCCTTGGTAGTTGATGCCACTGTCAAGACAGGCATCATGCGGCA
AATGGAAGCTTTTAGAGCTGGCTTCAATCAGGTCTTTGACATCACATCAT
TACAAATATTTACTCCTCATGAATTGGACCATCTGCTTTGTGGCCGTAGA
GAGTTGTGGGAGCCTGCGGCGCTTGCTGAGCATATAAAATTCGATCATGG
ATACACTGCCAAGAGTCCTGCAATTGTTAACTTACTAGAGATCATGGGAG
AATTCACACCAGATCAGCAGCGTGCCTTCTGTCAGTTTGTTACTGGTGCA
CCTCGTCTTCCACCGGGTGGGTTGGCGGTGCTGATTCCCAAGCTTACCAT
TGTCAGAAAGCATTCTTCAACTGCCCCTAATACACCATCCAATGGAAACG
GGGCCTTCGGAATCAGCGGAAGAATGACCTGGCCAAGTGTCATGACCTTG
GGCCAATTACCTGAAACCTTCCTCCCTTACTCTACCAAGGGAAATTATGT
ATCAAAAAAATTGGGTTTTAGCCAAAAAGCCAAAGGGGGAGGAAATCTTT
TTAATTTTTTCTTGGATTTTCCCAAAAACTTACCCCAAAGGGGACCTTTT
TGTAATTTTAAAATTTATTGTGTTCTTTCACAAGTCAATTTTCCCCTTTC
CCCCGGGGGGGAAATTATTTTTTCCTTTTTTTTAAAAAAAAAGAAACCCA
CTAATTTTTTTTTTCAAACATAAAAAAAAAAAAGGGGGCGCGTGCTTTTT
TTTTTTTCCCCGCCCCCCCTCCCCTTTTTTTTATATTTTCTCA
back to top