DY259896
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY259896 vs. ExPASy Swiss-Prot
Match: SAP3_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 3 OS=Arabidopsis thaliana GN=SAP3 PE=2 SV=1) HSP 1 Score: 92.0485 bits (227), Expect = 4.980e-18 Identity = 42/54 (77.78%), Postives = 45/54 (83.33%), Query Frame = 1 Query: 409 MAEEHRCQAPRLCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKHALNQTL 570 MAEEHR Q PRLC NNCGFFGS TQNLCSKCFRDLQ + Q SS+AKHAL Q+L Sbjct: 1 MAEEHRLQEPRLCANNCGFFGSTATQNLCSKCFRDLQHQEQNSSTAKHALTQSL 54
BLAST of DY259896 vs. ExPASy Swiss-Prot
Match: SAP4_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 4 OS=Arabidopsis thaliana GN=SAP4 PE=1 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 6.300e-13 Identity = 35/57 (61.40%), Postives = 40/57 (70.18%), Query Frame = 1 Query: 409 MAEEHRCQAP---RLCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSAKHALNQTL 570 MAEEHRC+ P RLCVNNCGFFGS T NLCS C+ DL LK QQ +S K + +L Sbjct: 1 MAEEHRCETPEGHRLCVNNCGFFGSSATMNLCSNCYGDLCLKQQQQASMKSTVESSL 57
BLAST of DY259896 vs. ExPASy Swiss-Prot
Match: SAP6_ARATH (Zinc finger A20 and AN1 domain-containing stress-associated protein 6 OS=Arabidopsis thaliana GN=SAP6 PE=2 SV=2) HSP 1 Score: 72.0182 bits (175), Expect = 5.333e-12 Identity = 34/49 (69.39%), Postives = 36/49 (73.47%), Query Frame = 1 Query: 409 MAEEHRCQAP---RLCVNNCGFFGSPTTQNLCSKCFRDLQLKAQQSSSA 546 MAEEHRCQ P RLCVNNCGF GS T NLCS C+ DL LK QQ SS+ Sbjct: 1 MAEEHRCQTPESNRLCVNNCGFLGSSATMNLCSNCYGDLCLKQQQQSSS 49 The following BLAST results are available for this feature:
BLAST of DY259896 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY259896 ID=DY259896; Name=DY259896; organism=Citrus clementina; type=EST; length=917bpback to top |